DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7101 and CG11695

DIOPT Version :9

Sequence 1:NP_573329.2 Gene:CG7101 / 32875 FlyBaseID:FBgn0030963 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster


Alignment Length:439 Identity:89/439 - (20%)
Similarity:124/439 - (28%) Gaps:174/439 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PVPIRPKAPGASNRGALPLAAKKP------AKKRT------------------------------ 31
            |.|||       .|..||.|...|      ||.||                              
  Fly   143 PSPIR-------RRMRLPRAVTAPKTQAVKAKARTKTHKAEADEDEDAEGEGDPESRSSNSREMD 200

  Fly    32 --------YHCGVC--------FAEFSRHLAAKRHEQQCSVRVRRLFVCPHCLTLFGEEARLERH 80
                    ..|.:|        |||..||.  :.|.|...     ..||  |...:.:.|....|
  Fly   201 SYIALHGRLECCICGGDEQFPNFAEMKRHF--RNHHQSLG-----YVVC--CQRRYKKRALYVDH 256

  Fly    81 RERKHNDGQFLCLQCGKKYASATFLYRHVASWHGQQS--LFYCDMCTDNCNDVKTFSGMLELQEH 143
            ....::...|.|..|.|:..|......|:..:|..:.  .|.||.|:      |.||....|..|
  Fly   257 LHMHNDPNYFRCKICSKQLVSRISYDVHMLRFHPNKDDLSFACDQCS------KRFSKQFLLTIH 315

  Fly   144 AEEVHRLRTLKSTASDADSQVDEMEDLEMLEENIENILPSIDWDDDLTFGWPTDLDKESCIVNAK 208
                              |:|.:.|..|.                                    
  Fly   316 ------------------SRVHQQERNEQ------------------------------------ 326

  Fly   209 PSVFVCPFCANGFPGSLSLVRHLEQVHERSALD--CCYCGKSHGSREALRSHLQRVH---ILLRG 268
                 |..|...|..::.|..|:.:.|:.:.:.  |..||....:::.|..|.:.||   ..|..
  Fly   327 -----CKHCDRSFRTAVDLRLHMRRTHDPAFVPFICDSCGAKFKTKQNLLVHKRTVHREGSQLPE 386

  Fly   269 HVCGICQADFATADHLKKHVNSLHLD----------------------------HRP---HLCPT 302
            ..|..||...:..:.|:||: .:|||                            |.|   |.|..
  Fly   387 VQCQECQVWLSDENSLRKHM-YMHLDAASLRQWKCEQCGLEKGSRAKLAAHIRYHHPKEYHKCTH 450

  Fly   303 CGKRFTQRCHLTDHIKTDRGHGHGTYTCEFCVRPFFRAIDLERHVCEEH 351
            |.|.|.....|.:|..|..  |...|.|.||.|.|..:.::.:|..:.|
  Fly   451 CAKEFKSSRSLEEHTATHT--GQDLYECAFCERTFKNSGNMHKHRRQMH 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7101NP_573329.2 PHA00733 <210..263 CDD:177301 11/54 (20%)
C2H2 Zn finger 242..263 CDD:275368 5/20 (25%)
C2H2 Zn finger 271..292 CDD:275368 6/20 (30%)
C2H2 Zn finger 300..319 CDD:275368 6/18 (33%)
C2H2 Zn finger 330..347 CDD:275368 5/16 (31%)
CG11695NP_572732.1 zf-AD 2..81 CDD:285071
C2H2 Zn finger 268..289 CDD:275368 5/20 (25%)
C2H2 Zn finger 299..319 CDD:275368 9/43 (21%)
C2H2 Zn finger 327..348 CDD:275368 5/20 (25%)
C2H2 Zn finger 357..376 CDD:275368 5/18 (28%)
C2H2 Zn finger 389..409 CDD:275368 6/20 (30%)
C2H2 Zn finger 420..440 CDD:275368 0/19 (0%)
C2H2 Zn finger 448..468 CDD:275368 6/19 (32%)
C2H2 Zn finger 476..494 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455515
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.