DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7101 and CG2129

DIOPT Version :9

Sequence 1:NP_573329.2 Gene:CG7101 / 32875 FlyBaseID:FBgn0030963 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster


Alignment Length:361 Identity:79/361 - (21%)
Similarity:118/361 - (32%) Gaps:135/361 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RHLAAKRHEQQCSVRVRRLFVCPHCLTLFGEEARLERHRERKHND-------------------- 87
            ||.|...|.            ||||..::.....||||..|:|.|                    
  Fly   174 RHSAKIPHS------------CPHCTKVYQSRKVLERHIMRQHKDTLSPDVDSEDADYEPPKDAP 226

  Fly    88 -----GQFLCLQCGKKYASATFLYRHVASWH-----GQQSLFYCDMCTDNCNDVKTFSGMLELQE 142
                 .::.|..|||.|.....|.:|:...|     |..::|.|..|......::.      |.|
  Fly   227 VKSAAQEYKCEHCGKIYHGKYSLRQHLKRDHDNGEEGGSAIFTCLECEAQLPRLRL------LDE 285

  Fly   143 HAEEVH----------RLRT--------LKSTASDADSQVDEMEDLEMLEENIENILPSIDWDDD 189
            |..:.|          |.:|        ||.|:                |.|:.           
  Fly   286 HMVQAHGGAACVVCGRRYKTRHELKRHQLKHTS----------------ERNVP----------- 323

  Fly   190 LTFGWPTDLDKESCIVNAKPSVFVCPF--CANGFPGSLSLVRHLE---QVH-ERSALDCCYCGKS 248
                                    ||.  |...|    ..:||:.   :|| |:....|..||.|
  Fly   324 ------------------------CPHPGCGKRF----FTIRHMRNHGKVHTEQKNFVCESCGYS 360

  Fly   249 HGSREALRSHLQRVHILLRGHVCGICQADFATADHLKKHVNSLHLDHRPHLCPTCGKRFTQRCHL 313
            ..::|.||.|: |.|...|...|.:|...|.:...|::|: ::|...|||:|..||..|:::..|
  Fly   361 CRNKETLRVHI-RSHTGERPFGCQVCDKRFPSHSGLREHM-AMHSTERPHVCSVCGATFSRQKGL 423

  Fly   314 TDH--IKTDRGHGHGTYTCEFCVRPFFRAIDLERHV 347
            ..|  :..|...    :.|:.|...:.:|..|..|:
  Fly   424 YHHKFLHADTKQ----FVCKLCGNAYAQAAGLAGHM 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7101NP_573329.2 PHA00733 <210..263 CDD:177301 18/58 (31%)
C2H2 Zn finger 242..263 CDD:275368 9/20 (45%)
C2H2 Zn finger 271..292 CDD:275368 5/20 (25%)
C2H2 Zn finger 300..319 CDD:275368 6/20 (30%)
C2H2 Zn finger 330..347 CDD:275368 4/16 (25%)
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 3/19 (16%)
zf-C2H2_8 323..411 CDD:292531 29/128 (23%)
C2H2 Zn finger 327..346 CDD:275368 4/22 (18%)
C2H2 Zn finger 354..374 CDD:275368 9/20 (45%)
zf-H2C2_2 367..389 CDD:290200 8/22 (36%)
C2H2 Zn finger 382..402 CDD:275368 5/20 (25%)
zf-H2C2_2 395..419 CDD:290200 10/24 (42%)
C2H2 Zn finger 410..430 CDD:275368 6/19 (32%)
C2H2 Zn finger 438..458 CDD:275368 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440042
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.