DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7101 and mld

DIOPT Version :9

Sequence 1:NP_573329.2 Gene:CG7101 / 32875 FlyBaseID:FBgn0030963 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001247289.1 Gene:mld / 2768685 FlyBaseID:FBgn0263490 Length:1965 Species:Drosophila melanogaster


Alignment Length:534 Identity:98/534 - (18%)
Similarity:148/534 - (27%) Gaps:213/534 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PGASNRGA----LPLAAKKPAKKRTYHCGVCF--AEFSRHLAAKRHEQQCSVRVRRLFVCPHCLT 69
            |||::...    :|:.|.: .:..|..|..|.  ..||..|...||.......|.. |.||||..
  Fly  1339 PGATSISTKVTPIPVTAAR-GRPLTLKCRFCHNGPRFSSSLEYSRHIIDLHPAVAP-FNCPHCPM 1401

  Fly    70 LFGEEARLERHRERKHNDGQFLCLQCGKKYASATFLYRHVASWHGQQSLFYCDMCTDNCNDVKTF 134
            .|....:..:|....|...|:.|.||...:.:...|..|:..:|       ..:.||....||..
  Fly  1402 AFAGRTKRSQHILSHHVVQQYQCGQCSHVFPAQKALDVHIQRFH-------MTLKTDPSGAVKVE 1459

  Fly   135 SGMLEL------------------------------QEHAEEVHRLRTLKSTASDADSQVDE--- 166
            ...|::                              |:|.::...|:.|.........|..:   
  Fly  1460 DVQLQITSERRPRGRPYKPRLQLQQHQLQPQQKLQVQQHQQQQKALQQLPQAQHHQQQQQPQLQQ 1524

  Fly   167 --MEDLEMLEENIE------------------------------------------NILPSIDWD 187
              ::.::.|:..::                                          .||...|. 
  Fly  1525 EVLQQVQQLQVQVQPQQHQQHQQVLQVQQPQQQPLMQPQSPHPSTVEMQASPTTPRKILCCPDC- 1588

  Fly   188 DDLTFGW----------------PTDLDKESCIVNA---KPSVFV-------------------- 213
            :|.|.|.                ||.|...|.||:.   :|.|:.                    
  Fly  1589 EDCTSGHSHANEQFEELQTLQAPPTVLTPPSTIVSVPSPQPMVYSQHITMPSPEQSEPDSTTTLR 1653

  Fly   214 ----------------------------------------------------------------- 213
                                                                             
  Fly  1654 QYRKRGVIVGPQGPLHLATPVASPSPSSSPSSSTVDHIPPASPATPASPAPPPSPAVASTVQVSE 1718

  Fly   214 ------CPFCANGFPGSLSLVRHLEQVHERSALD-----CCYCGKSHGSREALRSHLQRVHILLR 267
                  |.:|...|...:||.:|.:..|  .||.     |..|.:.:..|.||..|::...:..|
  Fly  1719 LRTSHHCLYCEERFTNEISLKKHHQLAH--GALTTMPYVCTICKRGYRMRTALHRHMESHDVEGR 1781

  Fly   268 GHVCGICQADFATADHLKKHVNSLHLDHRPHLCPTCGKRFTQRCHLTDHIKTDRGHGHGTYTCEF 332
            .:.|.||:..|.....|..|..::||..:||.|..|||:|.....|..|||.   ||...|.|:.
  Fly  1782 PYECNICRVRFPRPSQLTLHKITVHLLSKPHTCDECGKQFGTESALKTHIKF---HGELGYQCDG 1843

  Fly   333 CVRPFFRAIDLERH 346
            |.|.|....:|.:|
  Fly  1844 CDRTFEYLKELRKH 1857

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7101NP_573329.2 PHA00733 <210..263 CDD:177301 16/148 (11%)
C2H2 Zn finger 242..263 CDD:275368 6/20 (30%)
C2H2 Zn finger 271..292 CDD:275368 6/20 (30%)
C2H2 Zn finger 300..319 CDD:275368 8/18 (44%)
C2H2 Zn finger 330..347 CDD:275368 6/17 (35%)
mldNP_001247289.1 zf-AD 186..255 CDD:214871
C2H2 Zn finger 1365..1388 CDD:275368 7/22 (32%)
C2H2 Zn finger 1396..1416 CDD:275368 6/19 (32%)
C2H2 Zn finger 1424..1445 CDD:275368 5/20 (25%)
C2H2 Zn finger 1725..1746 CDD:275368 6/20 (30%)
C2H2 Zn finger 1756..1776 CDD:275368 6/19 (32%)
C2H2 Zn finger 1785..1806 CDD:275368 6/20 (30%)
C2H2 Zn finger 1814..1834 CDD:275368 9/22 (41%)
zf-C2H2 1839..1861 CDD:278523 7/19 (37%)
C2H2 Zn finger 1841..1861 CDD:275368 6/17 (35%)
C2H2 Zn finger 1868..1888 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439974
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.