DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7101 and zag-1

DIOPT Version :9

Sequence 1:NP_573329.2 Gene:CG7101 / 32875 FlyBaseID:FBgn0030963 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_500424.3 Gene:zag-1 / 177144 WormBaseID:WBGene00006970 Length:596 Species:Caenorhabditis elegans


Alignment Length:263 Identity:61/263 - (23%)
Similarity:87/263 - (33%) Gaps:73/263 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 VASWHGQQSLFYCDMCTDNCNDVKTFSGMLELQEHAEEV---HRLRTLKSTASDADSQVDEMEDL 170
            :|:|..|.|         |.|:..|.|......|:.:||   ..|:..|.|..|.....|:.|. 
 Worm   313 MAAWASQFS---------NGNNSLTASQDERNNENTDEVMDHDGLKDGKETPLDLTLSTDDTEP- 367

  Fly   171 EMLEENIENILPSIDWDDDLTFGWPTDL-------------DKESCIVNAKPSVF------VCPF 216
            |...|.:...|       |.|.|...:|             |:|...:.|:.|..      :.|.
 Worm   368 EWSPEKLIGFL-------DQTGGVIQELLRQAGNGFVTNQEDEEEKPIKAEESPVSSGSSSIWPS 425

  Fly   217 CANGFP-----GSLS-LVRHLEQ--------------------------VHERSALDCCYCGKSH 249
            ....:|     .||| |.:.|:|                          ..|.....|..|.|..
 Worm   426 FIGQYPSILDSASLSVLEKALDQQKSSEDDASSLCSNESKLLKFPTTPLKEEEGLFSCDQCDKVF 490

  Fly   250 GSREALRSHLQRVHILLRGHVCGICQADFATADHLKKHVNSLHLDHRPHLCPTCGKRFTQRCHLT 314
            |.:.:|..| :..|...|.:.|.||:..|....||.:| ..||...:|..|..|.|||:.....:
 Worm   491 GKQSSLARH-KYEHSGQRPYKCDICEKAFKHKHHLTEH-KRLHSGEKPFQCDKCLKRFSHSGSYS 553

  Fly   315 DHI 317
            .|:
 Worm   554 QHM 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7101NP_573329.2 PHA00733 <210..263 CDD:177301 16/90 (18%)
C2H2 Zn finger 242..263 CDD:275368 6/20 (30%)
C2H2 Zn finger 271..292 CDD:275368 7/20 (35%)
C2H2 Zn finger 300..319 CDD:275368 6/18 (33%)
C2H2 Zn finger 330..347 CDD:275368
zag-1NP_500424.3 zf-C2H2 24..46 CDD:278523
C2H2 Zn finger 26..46 CDD:275368
zf-H2C2_2 38..61 CDD:290200
homeodomain 225..282 CDD:238039
C2H2 Zn finger 483..503 CDD:275368 6/20 (30%)
zf-H2C2_2 495..520 CDD:290200 8/25 (32%)
COG5048 506..>559 CDD:227381 17/52 (33%)
C2H2 Zn finger 511..531 CDD:275368 7/20 (35%)
zf-H2C2_2 523..548 CDD:290200 11/25 (44%)
C2H2 Zn finger 539..556 CDD:275368 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3134
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.