Sequence 1: | NP_573329.2 | Gene: | CG7101 / 32875 | FlyBaseID: | FBgn0030963 | Length: | 352 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_500424.3 | Gene: | zag-1 / 177144 | WormBaseID: | WBGene00006970 | Length: | 596 | Species: | Caenorhabditis elegans |
Alignment Length: | 263 | Identity: | 61/263 - (23%) |
---|---|---|---|
Similarity: | 87/263 - (33%) | Gaps: | 73/263 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 109 VASWHGQQSLFYCDMCTDNCNDVKTFSGMLELQEHAEEV---HRLRTLKSTASDADSQVDEMEDL 170
Fly 171 EMLEENIENILPSIDWDDDLTFGWPTDL-------------DKESCIVNAKPSVF------VCPF 216
Fly 217 CANGFP-----GSLS-LVRHLEQ--------------------------VHERSALDCCYCGKSH 249
Fly 250 GSREALRSHLQRVHILLRGHVCGICQADFATADHLKKHVNSLHLDHRPHLCPTCGKRFTQRCHLT 314
Fly 315 DHI 317 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7101 | NP_573329.2 | PHA00733 | <210..263 | CDD:177301 | 16/90 (18%) |
C2H2 Zn finger | 242..263 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 271..292 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 300..319 | CDD:275368 | 6/18 (33%) | ||
C2H2 Zn finger | 330..347 | CDD:275368 | |||
zag-1 | NP_500424.3 | zf-C2H2 | 24..46 | CDD:278523 | |
C2H2 Zn finger | 26..46 | CDD:275368 | |||
zf-H2C2_2 | 38..61 | CDD:290200 | |||
homeodomain | 225..282 | CDD:238039 | |||
C2H2 Zn finger | 483..503 | CDD:275368 | 6/20 (30%) | ||
zf-H2C2_2 | 495..520 | CDD:290200 | 8/25 (32%) | ||
COG5048 | 506..>559 | CDD:227381 | 17/52 (33%) | ||
C2H2 Zn finger | 511..531 | CDD:275368 | 7/20 (35%) | ||
zf-H2C2_2 | 523..548 | CDD:290200 | 11/25 (44%) | ||
C2H2 Zn finger | 539..556 | CDD:275368 | 5/16 (31%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S3134 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.950 |