DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7101 and ztf-29

DIOPT Version :9

Sequence 1:NP_573329.2 Gene:CG7101 / 32875 FlyBaseID:FBgn0030963 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_499490.1 Gene:ztf-29 / 176585 WormBaseID:WBGene00013438 Length:343 Species:Caenorhabditis elegans


Alignment Length:242 Identity:56/242 - (23%)
Similarity:77/242 - (31%) Gaps:73/242 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 FVCPHCLTLFGEEARLERHRERKHNDGQFLCLQCGKKYASATFLYRHVASWHGQQSLFYCDMCTD 126
            |:|.||...|...|.|.|||...|.|.| .||.|..|......:.||:...|..|.:|.|..|. 
 Worm    18 FLCGHCGKTFCHAASLNRHRLNFHGDDQ-QCLVCDTKIPHNDTIRRHMQKEHNIQRVFTCGCCN- 80

  Fly   127 NCNDVKTFSGMLELQEHAEEV------------------------HRLR------TLKSTASD-- 159
                 .||....||..|...:                        |.||      .:|...|.  
 Worm    81 -----WTFPDKKELHSHNNSMLKTGTPGTAKIIAVSSRRPGSLSQHELRGEERSPRIKKRPSSKA 140

  Fly   160 ---ADSQVDEMEDLEMLEENIEN----------ILPSI--DWDDDLTFGWPTDLDKESCIVNAKP 209
               :|:.:...:.:..|..|:.:          ..|:|  .|.|.|....|.             
 Worm   141 MKTSDTPLTGHDQILALLSNLMSAQQQQQQAPVATPTIPASWIDQLLAATPA------------- 192

  Fly   210 SVFVCPF--CANGFPGSLSLVRHLEQVHERSALDCCYCGKSHGSREA 254
               :.||  .::.|..| |....:||..|.|:||.......:.:.||
 Worm   193 ---LLPFMPSSSTFSAS-SSSSEMEQTPEPSSLDTVLTSMMNNNEEA 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7101NP_573329.2 PHA00733 <210..263 CDD:177301 13/47 (28%)
C2H2 Zn finger 242..263 CDD:275368 2/13 (15%)
C2H2 Zn finger 271..292 CDD:275368
C2H2 Zn finger 300..319 CDD:275368
C2H2 Zn finger 330..347 CDD:275368
ztf-29NP_499490.1 COG5236 <15..>92 CDD:227561 28/80 (35%)
C2H2 Zn finger 20..40 CDD:275368 9/19 (47%)
C2H2 Zn finger 47..68 CDD:275368 6/20 (30%)
C2H2 Zn finger 76..92 CDD:275368 6/21 (29%)
U2AF_lg 112..>191 CDD:273727 13/78 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3134
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.