Sequence 1: | NP_573329.2 | Gene: | CG7101 / 32875 | FlyBaseID: | FBgn0030963 | Length: | 352 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_499490.1 | Gene: | ztf-29 / 176585 | WormBaseID: | WBGene00013438 | Length: | 343 | Species: | Caenorhabditis elegans |
Alignment Length: | 242 | Identity: | 56/242 - (23%) |
---|---|---|---|
Similarity: | 77/242 - (31%) | Gaps: | 73/242 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 FVCPHCLTLFGEEARLERHRERKHNDGQFLCLQCGKKYASATFLYRHVASWHGQQSLFYCDMCTD 126
Fly 127 NCNDVKTFSGMLELQEHAEEV------------------------HRLR------TLKSTASD-- 159
Fly 160 ---ADSQVDEMEDLEMLEENIEN----------ILPSI--DWDDDLTFGWPTDLDKESCIVNAKP 209
Fly 210 SVFVCPF--CANGFPGSLSLVRHLEQVHERSALDCCYCGKSHGSREA 254 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7101 | NP_573329.2 | PHA00733 | <210..263 | CDD:177301 | 13/47 (28%) |
C2H2 Zn finger | 242..263 | CDD:275368 | 2/13 (15%) | ||
C2H2 Zn finger | 271..292 | CDD:275368 | |||
C2H2 Zn finger | 300..319 | CDD:275368 | |||
C2H2 Zn finger | 330..347 | CDD:275368 | |||
ztf-29 | NP_499490.1 | COG5236 | <15..>92 | CDD:227561 | 28/80 (35%) |
C2H2 Zn finger | 20..40 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 47..68 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 76..92 | CDD:275368 | 6/21 (29%) | ||
U2AF_lg | 112..>191 | CDD:273727 | 13/78 (17%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S3134 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.950 |