DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7101 and ZNF497

DIOPT Version :9

Sequence 1:NP_573329.2 Gene:CG7101 / 32875 FlyBaseID:FBgn0030963 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001193938.1 Gene:ZNF497 / 162968 HGNCID:23714 Length:498 Species:Homo sapiens


Alignment Length:321 Identity:86/321 - (26%)
Similarity:111/321 - (34%) Gaps:82/321 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GALPLAAKKPAKKRTYHCGVCFAEFSR-------HLAAKRHEQQCSVRVRRLFVCPHCLTLFGEE 74
            ||.|.|.:        .||..|::.|.       |..|:.|            .||.|...|...
Human   242 GARPHACR--------DCGKAFSQSSNLAEHLKIHAGARPH------------ACPDCGKAFVRV 286

  Fly    75 ARLERHRERKHNDGQFLCLQCGKKYASATFLYRHVASWHGQQSLFYCDMCTDNCNDVKTFSGMLE 139
            |.|.:||....::..|.|.:|||.:..::.|.:|..:..|::. |.|..|.      :.|.....
Human   287 AGLRQHRRTHSSEKPFPCAECGKAFRESSQLLQHQRTHTGERP-FECAECG------QAFVMGSY 344

  Fly   140 LQEH-----AEEVHRLRTLKSTASDADSQVDEMEDLEMLEENIENILPSIDWDDDLTFGWPTDLD 199
            |.||     .|:.|..    :....|.||...:                              |.
Human   345 LAEHRRVHTGEKPHAC----AQCGKAFSQRSNL------------------------------LS 375

  Fly   200 KESCIVNAKPSVFVCPFCANGFPGSLSLVRH-LEQVHERSALDCCYCGKSHGSREALRSHLQRVH 263
            .......|||  |.|..|...|.||..|..| |....|| ...|..|||:......||.| ||:|
Human   376 HRRTHSGAKP--FACADCGKAFRGSSGLAHHRLSHTGER-PFACAECGKAFRGSSELRQH-QRLH 436

  Fly   264 ILLRGHVCGICQADFATADHLKKHVNSLHLDHRPHLCPTCGKRFTQRCHLTDHIKTDRGHG 324
            ...|..||..|...|.....|..| ...|...||:.|..|||.|:.||:|.:|.|.   ||
Human   437 SGERPFVCAHCSKAFVRKSELLSH-RRTHTGERPYACGECGKPFSHRCNLNEHQKR---HG 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7101NP_573329.2 PHA00733 <210..263 CDD:177301 20/53 (38%)
C2H2 Zn finger 242..263 CDD:275368 9/20 (45%)
C2H2 Zn finger 271..292 CDD:275368 5/20 (25%)
C2H2 Zn finger 300..319 CDD:275368 9/18 (50%)
C2H2 Zn finger 330..347 CDD:275368
ZNF497NP_001193938.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..104
COG5048 107..492 CDD:227381 84/318 (26%)
C2H2 Zn finger 108..128 CDD:275368
zf-H2C2_2 120..144 CDD:290200
C2H2 Zn finger 136..156 CDD:275368
zf-H2C2_2 148..171 CDD:290200
C2H2 Zn finger 164..184 CDD:275368
zf-C2H2 190..212 CDD:278523
C2H2 Zn finger 192..212 CDD:275368
zf-H2C2_2 205..228 CDD:290200
C2H2 Zn finger 220..240 CDD:275368
C2H2 Zn finger 248..268 CDD:275368 4/27 (15%)
C2H2 Zn finger 276..296 CDD:275368 8/19 (42%)
zf-H2C2_2 289..311 CDD:290200 8/21 (38%)
C2H2 Zn finger 304..324 CDD:275368 6/19 (32%)
zf-H2C2_2 317..340 CDD:290200 6/29 (21%)
C2H2 Zn finger 332..352 CDD:275368 6/25 (24%)
zf-H2C2_2 344..369 CDD:290200 6/28 (21%)
C2H2 Zn finger 360..380 CDD:275368 4/53 (8%)
C2H2 Zn finger 388..408 CDD:275368 8/19 (42%)
C2H2 Zn finger 416..436 CDD:275368 9/20 (45%)
zf-H2C2_2 428..453 CDD:290200 11/25 (44%)
C2H2 Zn finger 444..464 CDD:275368 5/20 (25%)
zf-H2C2_2 456..481 CDD:290200 10/25 (40%)
C2H2 Zn finger 472..492 CDD:275368 10/22 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142288
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.