DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42450 and rgs13b

DIOPT Version :10

Sequence 1:NP_001259691.1 Gene:CG42450 / 32874 FlyBaseID:FBgn0259927 Length:1280 Species:Drosophila melanogaster
Sequence 2:XP_001332101.7 Gene:rgs13b / 792554 ZFINID:ZDB-GENE-110914-230 Length:183 Species:Danio rerio


Alignment Length:146 Identity:53/146 - (36%)
Similarity:89/146 - (60%) Gaps:9/146 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   481 QLNNTFVDIPTEKRV-----KRWAISIEELVSDPTGLQEFTGFLEKEYSHENIRFWIAVNRLR-- 538
            :|.:.|......:|:     ::|:.|:|.|:....||..|..||:.|:|.|||.||:.....:  
Zfish    32 RLKSMFAGSSVPERLSLEDTQQWSQSLERLLGSKYGLATFRTFLKSEFSDENIEFWLTCEDYKTI 96

  Fly   539 RSAHSQVARKVNEIYEEFLKPGAPCEINIDGKTMESVLKGLKNPSRFTFDSASEHIYMLLLKKDC 603
            .|:| :::.|..:|:|:|::..:|.|||||.:|.|.:.:.:|:|:...||.|.:.:|. |:::|.
Zfish    97 TSSH-KMSSKARKIFEQFVEAESPKEINIDYQTREEIKRKMKSPTAQCFDEAQKIVYG-LMERDS 159

  Fly   604 YPRFIRSEHYKRLLDT 619
            ||||:|||.||.||:|
Zfish   160 YPRFLRSEMYKSLLET 175

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG42450NP_001259691.1 DEP_RGS7-like 219..306 CDD:239897
RGS_DHEX 303..401 CDD:375589