DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42450 and RGS18

DIOPT Version :10

Sequence 1:NP_001259691.1 Gene:CG42450 / 32874 FlyBaseID:FBgn0259927 Length:1280 Species:Drosophila melanogaster
Sequence 2:NP_570138.1 Gene:RGS18 / 64407 HGNCID:14261 Length:235 Species:Homo sapiens


Alignment Length:131 Identity:49/131 - (37%)
Similarity:79/131 - (60%) Gaps:3/131 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   489 IPTEKRVKRWAISIEELVSDPTGLQEFTGFLEKEYSHENIRFWIAVNRLRRS-AHSQVARKVNEI 552
            :..|:.|| |..|.::|:|...||:.||.||:.|:|.|||.||||....::| ...|:..|...|
Human    75 VSPEEAVK-WGESFDKLLSHRDGLEAFTRFLKTEFSEENIEFWIACEDFKKSKGPQQIHLKAKAI 138

  Fly   553 YEEFLKPGAPCEINIDGKTMESVLKGLKNPSRFTFDSASEHIYMLLLKKDCYPRFIRSEHYKRLL 617
            ||:|::..||.|:|:|..|.|.:...:..|:..:||:|...:|. |:::|.|.||::|:.|..|:
Human   139 YEKFIQTDAPKEVNLDFHTKEVITNSITQPTLHSFDAAQSRVYQ-LMEQDSYTRFLKSDIYLDLM 202

  Fly   618 D 618
            :
Human   203 E 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42450NP_001259691.1 DEP_RGS7-like 219..306 CDD:239897
RGS_DHEX 303..401 CDD:375589
G-gamma 418..482 CDD:459879
RGS_R7-like 494..614 CDD:188660 46/120 (38%)
RGS18NP_570138.1 RGS_RGS18 87..200 CDD:188667 43/113 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.