DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42450 and RGS3

DIOPT Version :10

Sequence 1:NP_001259691.1 Gene:CG42450 / 32874 FlyBaseID:FBgn0259927 Length:1280 Species:Drosophila melanogaster
Sequence 2:NP_652759.4 Gene:RGS3 / 5998 HGNCID:9999 Length:1094 Species:Homo sapiens


Alignment Length:130 Identity:46/130 - (35%)
Similarity:76/130 - (58%) Gaps:2/130 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   490 PTEKRVKRWAISIEELVSDPTGLQEFTGFLEKEYSHENIRFWIAVNRLRR-SAHSQVARKVNEIY 553
            ||.:...:|..|:|:|:....||..|..||..|:|.||:.||:|....:: .:.|::|.|..:|:
Human   958 PTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIF 1022

  Fly   554 EEFLKPGAPCEINIDGKTMESVLKGLKNPSRFTFDSASEHIYMLLLKKDCYPRFIRSEHYKRLLD 618
            .|::...|..|:|:|..|.|.....|::.:|..||.|.:.|:. |::||.||||:||:.|..|::
Human  1023 AEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFG-LMEKDSYPRFLRSDLYLDLIN 1086

  Fly   619  618
            Human  1087  1086

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42450NP_001259691.1 DEP_RGS7-like 219..306 CDD:239897
RGS_DHEX 303..401 CDD:375589
G-gamma 418..482 CDD:459879
RGS_R7-like 494..614 CDD:188660 42/120 (35%)
RGS3NP_652759.4 C2_RGS-like 35..154 CDD:176067
PDZ_RGS3-like 194..270 CDD:467195
PHA03247 <586..748 CDD:223021
RGS_RGS3 970..1083 CDD:188668 41/113 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.