DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42450 and RGS2

DIOPT Version :10

Sequence 1:NP_001259691.1 Gene:CG42450 / 32874 FlyBaseID:FBgn0259927 Length:1280 Species:Drosophila melanogaster
Sequence 2:NP_002914.1 Gene:RGS2 / 5997 HGNCID:9998 Length:211 Species:Homo sapiens


Alignment Length:196 Identity:53/196 - (27%)
Similarity:100/196 - (51%) Gaps:16/196 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   426 RDVDYLGKSLNRTRMKMSQACESLVCYSETFSEYDFFLQ----PALPSNPWVTEDIAFWQLNNTF 486
            |.:|....|.:::..|..:...:|:  .:..:...:|||    |..|.....::..||.:     
Human    14 RPMDKSAGSGHKSEEKREKMKRTLL--KDWKTRLSYFLQNSSTPGKPKTGKKSKQQAFIK----- 71

  Fly   487 VDIPTEKRVKRWAISIEELVSDPTGLQEFTGFLEKEYSHENIRFWIAVNRLRRSAHSQ-VARKVN 550
               |:.:..:.|:.:.:||::...||..|..||:.|:..|||.||:|....:::...| ::.|..
Human    72 ---PSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQKLSSKAR 133

  Fly   551 EIYEEFLKPGAPCEINIDGKTMESVLKGLKNPSRFTFDSASEHIYMLLLKKDCYPRFIRSEHYKR 615
            :||.:|::..||.|||||.:|...:.:.::..:...|.:|.:.:|. |::.:.||||:.||.|:.
Human   134 KIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYS-LMENNSYPRFLESEFYQD 197

  Fly   616 L 616
            |
Human   198 L 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42450NP_001259691.1 DEP_RGS7-like 219..306 CDD:239897
RGS_DHEX 303..401 CDD:375589
G-gamma 418..482 CDD:459879 12/59 (20%)
RGS_R7-like 494..614 CDD:188660 38/120 (32%)
RGS2NP_002914.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 14..33 4/18 (22%)
Necessary for membrane association. /evidence=ECO:0000269|PubMed:11278586 32..66 6/35 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 49..68 4/18 (22%)
Necessary to inhibit protein synthesis. /evidence=ECO:0000269|PubMed:19736320 79..116 14/36 (39%)
RGS_RGS2 84..197 CDD:188664 38/113 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.