DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42450 and Rgs1

DIOPT Version :10

Sequence 1:NP_001259691.1 Gene:CG42450 / 32874 FlyBaseID:FBgn0259927 Length:1280 Species:Drosophila melanogaster
Sequence 2:NP_056626.2 Gene:Rgs1 / 50778 MGIID:1354694 Length:209 Species:Mus musculus


Alignment Length:131 Identity:51/131 - (38%)
Similarity:79/131 - (60%) Gaps:1/131 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   488 DIPTEKRVKRWAISIEELVSDPTGLQEFTGFLEKEYSHENIRFWIAVNRLRRSAHSQVARKVNEI 552
            ||.:.:.|.:|:.|:|:|:::.||...|..||:.|:|.|||.||:|....:::....:..|...|
Mouse    72 DILSAEEVMQWSQSLEKLLANQTGQNVFGRFLKSEFSEENIEFWLACEDYKKTETDLLHNKAENI 136

  Fly   553 YEEFLKPGAPCEINIDGKTMESVLKGLKNPSRFTFDSASEHIYMLLLKKDCYPRFIRSEHYKRLL 617
            |:.|:...|..:||||..|.||..|.:|.|:..:||.|.:.||. |::||.||||::|..|..||
Mouse   137 YKAFVHSDAVKQINIDFHTRESTAKKIKTPTPTSFDEAQKVIYS-LMEKDSYPRFLKSNIYLNLL 200

  Fly   618 D 618
            :
Mouse   201 N 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42450NP_001259691.1 DEP_RGS7-like 219..306 CDD:239897
RGS_DHEX 303..401 CDD:375589
G-gamma 418..482 CDD:459879
RGS_R7-like 494..614 CDD:188660 46/119 (39%)
Rgs1NP_056626.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..42
RGS 86..199 CDD:470619 44/113 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.