DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42450 and rgs3a

DIOPT Version :10

Sequence 1:NP_001259691.1 Gene:CG42450 / 32874 FlyBaseID:FBgn0259927 Length:1280 Species:Drosophila melanogaster
Sequence 2:NP_001417764.1 Gene:rgs3a / 445235 ZFINID:ZDB-GENE-040801-150 Length:896 Species:Danio rerio


Alignment Length:170 Identity:53/170 - (31%)
Similarity:86/170 - (50%) Gaps:22/170 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   481 QLNNTFVDI-PTEKRVKRWAISIEELVSDPTGLQEFTGFLEKEYSHENIRFWIAVNRLRR-SAHS 543
            :|:.|...: ||.:...:|..|:::|:....||..|..||..|:|.||:.||:|....:: .:.|
Zfish   745 KLDKTMKSVKPTPEEAMKWGESLDKLLVHKYGLAAFRAFLRTEFSEENLDFWLACEDYKKIKSQS 809

  Fly   544 QVARKVNEIYEEFLKPGAPCEINIDGKTMESVLKGLKNPSRFTFDSASEHIYMLLLKKDCYPRFI 608
            ::..|..:|:.||:...:..|:|:|..|.|...:.|:|.:|..|:.|...||. |::||.||||:
Zfish   810 KMTSKAKKIFAEFIAIQSCKEVNLDSYTREHTKENLQNINRSCFELAQRRIYG-LMEKDSYPRFL 873

  Fly   609 RSEHYKRLLDTGIQPSYKKRFFNFGGVSGAKKKMTAALSS 648
            |||.|..|::                   .||..|.:.||
Zfish   874 RSELYMDLVN-------------------QKKPSTTSTSS 894

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG42450NP_001259691.1 DEP_RGS7-like 219..306 CDD:239897
RGS_DHEX 303..401 CDD:375589