DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7058 and SPOP

DIOPT Version :9

Sequence 1:NP_573327.2 Gene:CG7058 / 32873 FlyBaseID:FBgn0030961 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_001007227.1 Gene:SPOP / 8405 HGNCID:11254 Length:374 Species:Homo sapiens


Alignment Length:437 Identity:93/437 - (21%)
Similarity:158/437 - (36%) Gaps:145/437 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   662 TFC--EMDFLSKSSTINQNLEQLIMDIPAYIFIVENLSDRLDDKLGW------------------ 706
            :||  ||..:.||||                     .|...:|||.|                  
Human    42 SFCREEMGEVIKSST---------------------FSSGANDKLKWCLRVNPKGLDEESKDYLS 85

  Fly   707 ----------KEFKFCFKLATSQINGVIAKLLEHKDALRDAISQICMLVRKQE--FTQSVIELGL 759
                      .|.:..||.:.....|...|.:|.:.|.|        .|:.::  |.:.:....|
Human    86 LYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYR--------FVQGKDWGFKKFIRRDFL 142

  Fly   760 LDDTCLLSNNLKMADHENNLNQGLSEKDSMYLDRKQYYDYNSIKLNLIRHLCEPPIAASS-NLS- 822
            ||:.                 .||...|.:.|                  .||..:...| |:| 
Human   143 LDEA-----------------NGLLPDDKLTL------------------FCEVSVVQDSVNISG 172

  Fly   823 KNALRLLH--STQLADMEFEVHTYAPTSGAAKSGGGTEAVPETAEPAAKVLQVHSFKAHRVIVAA 885
            :|.:.::.  ..:|||               :.||..|....|  .....:....|:||:.|:||
Human   173 QNTMNMVKVPECRLAD---------------ELGGLWENSRFT--DCCLCVAGQEFQAHKAILAA 220

  Fly   886 RCEWFKKALMSGMQESINRKVIITDTSPVIFRRLLLYLY--GAP-IDRTVGAEQVCELMLLADRY 947
            |...|.......|:||...:|.|.|..|.:|:.::.::|  .|| :|:...     :|:..||:|
Human   221 RSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMAD-----DLLAAADKY 280

  Fly   948 SIDDLKELCENTLYSLIDEDSVVCLLGIADRYMATALKSKCLSFLSQHAQLTKCEIFKELPQTLQ 1012
            :::.||.:||:.|.|.:..::...:|.:||.:.|..||::.:.|::.||.               
Human   281 ALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHAS--------------- 330

  Fly  1013 LEVMDLIHWFGR-VSEP-WNDRGFKPRSSSRHSLKSPSKPRSRSRKS 1057
             :|::...|... ||.| .....::..:|::.....|  ||.|.::|
Human   331 -DVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGP--PRKRLKQS 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7058NP_573327.2 BTB 870..964 CDD:197585 30/96 (31%)
BTB 870..960 CDD:279045 28/92 (30%)
SPOP_C_like 964..1016 CDD:269810 9/51 (18%)
SPOPNP_001007227.1 MATH_SPOP 28..166 CDD:239743 32/187 (17%)
Required for nuclear localization 71..191 26/177 (15%)
Important for binding substrate proteins 123..133 2/17 (12%)
BTB_POZ_SPOP-like 182..301 CDD:349588 37/140 (26%)
Important for homodimerization 186..217 10/47 (21%)
BACK_SPOP 297..367 CDD:350593 16/87 (18%)
Important for homodimerization 297..355 14/73 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1987
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.