DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7058 and Spopl

DIOPT Version :9

Sequence 1:NP_573327.2 Gene:CG7058 / 32873 FlyBaseID:FBgn0030961 Length:1062 Species:Drosophila melanogaster
Sequence 2:XP_006498475.1 Gene:Spopl / 76857 MGIID:1924107 Length:404 Species:Mus musculus


Alignment Length:281 Identity:68/281 - (24%)
Similarity:115/281 - (40%) Gaps:68/281 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   803 KLNLIRHLCEPPIA-----ASSNLSKNALR------------LLHSTQLADMEFEVHTYAPTSGA 850
            ||.|   .||..:.     .|.:.|.|.|:            |..:|:..|..|.|.        
Mouse   166 KLTL---FCEVSVVQDSVNVSGHTSTNTLKVPECRLAEDLGNLWENTRFTDCCFFVR-------- 219

  Fly   851 AKSGGGTEAVPETAEPAAKVLQVHSFKAHRVIVAARCEWFKKALMSGMQESINRKVIITDTSPVI 915
                 |.|                 ||||:.::|||...|.......|:|....:|.|.|..|.:
Mouse   220 -----GKE-----------------FKAHKSVLAARSPVFNAMFEHEMEECTKNRVEINDLDPEV 262

  Fly   916 FRRLLLYLY--GAP-IDRTVGAEQVCELMLLADRYSIDDLKELCENTLYSLIDEDSVVCLLGIAD 977
            |:.::.::|  .|| :|:...     .|:..||:|:::.||.:||..|.|.:..::|...|.:||
Mouse   263 FKEMMRFVYTGKAPNLDKMAD-----NLLAAADKYALERLKVMCEEALCSNLSVENVADTLVLAD 322

  Fly   978 RYMATALKSKCLSFLSQHAQLTK--CEIFKELPQTLQLEVMDLIHWFGRV-SEP-WNDRGFKPRS 1038
            .:.|..||::.:.|:::.:.|.:  |:..|........::|:...|...: |.| .....|:..:
Mouse   323 LHSAEQLKAQAIDFINRCSVLRQLGCKDGKNWNNNQATDIMETSGWKSMIQSHPHLVAEAFRALA 387

  Fly  1039 SSRHSLKSP--SKPRSRSRKS 1057
            ||    :.|  ..||.|.::|
Mouse   388 SS----QCPQFGIPRKRLKQS 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7058NP_573327.2 BTB 870..964 CDD:197585 29/96 (30%)
BTB 870..960 CDD:279045 27/92 (29%)
SPOP_C_like 964..1016 CDD:269810 11/53 (21%)
SpoplXP_006498475.1 MATH <80..178 CDD:351761 5/14 (36%)
BTB_POZ 191..313 CDD:365784 37/156 (24%)
BACK_SPOPL 309..404 CDD:350594 22/98 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1987
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.