DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7058 and SPOPL

DIOPT Version :9

Sequence 1:NP_573327.2 Gene:CG7058 / 32873 FlyBaseID:FBgn0030961 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_001001664.1 Gene:SPOPL / 339745 HGNCID:27934 Length:392 Species:Homo sapiens


Alignment Length:380 Identity:85/380 - (22%)
Similarity:147/380 - (38%) Gaps:121/380 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   662 TFC--EMDFLSKSSTINQNLEQLIMDIPAYIFIVENLSDRLDDKLGWKEFKFCFKLATSQINGVI 724
            :||  ||..:.||||.:..        |:             ||:.|     |.::....::   
Human    42 SFCREEMGEVLKSSTFSSG--------PS-------------DKMKW-----CLRVNPKGLD--- 77

  Fly   725 AKLLEHKDALRDAISQICMLVR--KQEFTQSVIELGLLDDTCLLSNNLKMADHENNLNQG----L 783
                   |..:|.:|...:||.  |.| .::..:..||        |.|..:.:...:|.    :
Human    78 -------DESKDYLSLYLLLVSCPKSE-VRAKFKFSLL--------NAKREETKAMESQRAYRFV 126

  Fly   784 SEKD---SMYLDRKQYYD-YNSI----KLNLIRHLCEPPIAASS-NLS----KNALR-------- 827
            ..||   ..::.|....| .|.:    ||.|   .||..:...| |:|    .|.|:        
Human   127 QGKDWGFKKFIRRDFLLDEANGLLPDDKLTL---FCEVSVVQDSVNISGHTNTNTLKVPECRLAE 188

  Fly   828 ----LLHSTQLADMEFEVHTYAPTSGAAKSGGGTEAVPETAEPAAKVLQVHSFKAHRVIVAARCE 888
                |..:|:..|..|.|.             |.|                 ||||:.::|||..
Human   189 DLGNLWENTRFTDCSFFVR-------------GQE-----------------FKAHKSVLAARSP 223

  Fly   889 WFKKALMSGMQESINRKVIITDTSPVIFRRLLLYLYGAPIDRTVGAEQVCE-LMLLADRYSIDDL 952
            .|.......|:||...:|.|.|..|.:|:.::.::|   ..|....:::.: |:..||:|:::.|
Human   224 VFNAMFEHEMEESKKNRVEINDLDPEVFKEMMRFIY---TGRAPNLDKMADNLLAAADKYALERL 285

  Fly   953 KELCENTLYSLIDEDSVVCLLGIADRYMATALKSKCLSFLSQHAQLTKCEIFKEL 1007
            |.:||..|.|.:..::|...|.:||.:.|..||::.:.|::      :|.:.::|
Human   286 KVMCEEALCSNLSVENVADTLVLADLHSAEQLKAQAIDFIN------RCSVLRQL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7058NP_573327.2 BTB 870..964 CDD:197585 28/94 (30%)
BTB 870..960 CDD:279045 26/90 (29%)
SPOP_C_like 964..1016 CDD:269810 10/44 (23%)
SPOPLNP_001001664.1 MATH 28..166 CDD:351761 35/171 (20%)
BTB_POZ_SPOPL 179..301 CDD:349652 36/154 (23%)
BACK_SPOPL 297..392 CDD:350594 10/44 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1987
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.