DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7058 and RGD1566337

DIOPT Version :9

Sequence 1:NP_573327.2 Gene:CG7058 / 32873 FlyBaseID:FBgn0030961 Length:1062 Species:Drosophila melanogaster
Sequence 2:XP_003749378.2 Gene:RGD1566337 / 310589 RGDID:1566337 Length:364 Species:Rattus norvegicus


Alignment Length:186 Identity:47/186 - (25%)
Similarity:80/186 - (43%) Gaps:18/186 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   870 VLQVHSFKAHRVIVAARCEWFKKALMSGMQESINRKVIITDTSPVIFRRLLLYLYGAPIDRTVGA 934
            |:....|:||:.|:|||...|:......|.||:..::.|.|....:|:.::.::|..........
  Rat   193 VVAGQEFRAHKAILAARSPVFRAMFEHEMLESLTNRIEIHDIHLHVFKEMMGFIYTGKAPHLHSH 257

  Fly   935 EQVCELMLLADRYSIDDLKELCENTLYSLIDEDSVVCLLGIADRYMATALKSKCLSFLSQHAQLT 999
            .....|:..||.|.:.|||.:||:.|...:..::.|..|.:||.:....||:|.:.|:..||.  
  Rat   258 SMATRLLAAADMYDLQDLKVMCEDALCRNLSVENAVSTLILADFHSTEHLKTKAMDFIILHAS-- 320

  Fly  1000 KCEIFKELPQTLQLEVMDLIHWFGRV-SEP-WNDRGFKPRSSSRHSLKSPSKPRSR 1053
                          ||.:.:.|...| |.| ..:..|:..:|.:.....||..|.:
  Rat   321 --------------EVSETLGWKSMVESHPHLVEEAFRSLASIQCPFLEPSLKRRK 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7058NP_573327.2 BTB 870..964 CDD:197585 26/93 (28%)
BTB 870..960 CDD:279045 25/89 (28%)
SPOP_C_like 964..1016 CDD:269810 11/51 (22%)
RGD1566337XP_003749378.2 MATH 16..153 CDD:351761
BTB_POZ 165..292 CDD:365784 26/98 (27%)
BACK 287..353 CDD:421692 18/81 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.