Sequence 1: | NP_573327.2 | Gene: | CG7058 / 32873 | FlyBaseID: | FBgn0030961 | Length: | 1062 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017447114.1 | Gene: | Spopl / 296532 | RGDID: | 1305847 | Length: | 424 | Species: | Rattus norvegicus |
Alignment Length: | 199 | Identity: | 51/199 - (25%) |
---|---|---|---|
Similarity: | 92/199 - (46%) | Gaps: | 34/199 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 876 FKAHRVIVAARCEWFKKALMSGMQESINRKVIITDTSPVIFRRLLLYLY--GAP-IDRTVGAEQV 937
Fly 938 CELMLLADRYSIDDLKELCENTLYSLIDEDSVVCLLGIADRYMATALKSKCLSFLSQHAQLTKCE 1002
Fly 1003 IFKELPQTLQLEVMDLIHW-FGRVSEPWNDRGFKPRSSSRHSLKSPS-------------KPRSR 1053
Fly 1054 SRKS 1057 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7058 | NP_573327.2 | BTB | 870..964 | CDD:197585 | 29/90 (32%) |
BTB | 870..960 | CDD:279045 | 27/86 (31%) | ||
SPOP_C_like | 964..1016 | CDD:269810 | 11/51 (22%) | ||
Spopl | XP_017447114.1 | MATH | 28..160 | CDD:351761 | |
BTB_POZ | 211..333 | CDD:365784 | 29/94 (31%) | ||
BACK_SPOPL | 329..424 | CDD:350594 | 21/106 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1987 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |