DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7058 and Tdpoz8

DIOPT Version :9

Sequence 1:NP_573327.2 Gene:CG7058 / 32873 FlyBaseID:FBgn0030961 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_001171165.1 Gene:Tdpoz8 / 229571 MGIID:3645677 Length:370 Species:Mus musculus


Alignment Length:123 Identity:33/123 - (26%)
Similarity:61/123 - (49%) Gaps:0/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   874 HSFKAHRVIVAARCEWFKKALMSGMQESINRKVIITDTSPVIFRRLLLYLYGAPIDRTVGAEQVC 938
            |.|:||:||:|||...|:......|:..:..:|.|.|..|.:|:.::.::|..............
Mouse   197 HEFRAHKVILAARSPVFRAMFEHEMKVRLTNRVEIHDLDPQVFKEMMGFIYTGKASHLHSYSMAS 261

  Fly   939 ELMLLADRYSIDDLKELCENTLYSLIDEDSVVCLLGIADRYMATALKSKCLSFLSQHA 996
            :::..|||..:..||.:||:.|...:..::....|.:||.:....||.:.|.|::.:|
Mouse   262 DVLAAADRCGLKGLKVMCEDALCRNLSVENAAHTLILADLHSIEHLKIQALDFITVYA 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7058NP_573327.2 BTB 870..964 CDD:197585 25/89 (28%)
BTB 870..960 CDD:279045 24/85 (28%)
SPOP_C_like 964..1016 CDD:269810 8/33 (24%)
Tdpoz8NP_001171165.1 MATH 16..154 CDD:295307
BTB 180..284 CDD:279045 24/86 (28%)
BTB 189..287 CDD:197585 25/89 (28%)
SPOP_C 287..348 CDD:269807 8/33 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.