DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bnb and Akap14

DIOPT Version :9

Sequence 1:NP_523406.1 Gene:bnb / 32872 FlyBaseID:FBgn0001090 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001028957.1 Gene:Akap14 / 434756 MGIID:3618288 Length:536 Species:Mus musculus


Alignment Length:382 Identity:108/382 - (28%)
Similarity:159/382 - (41%) Gaps:55/382 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 PAKEINSVELKSSAPDVETAPAIPEKK--TLPEEAKPAQENAPVEAEKKQEKTARTEAEP---TV 150
            |.::...||..|:|...:  |..||.|  |.|:::|..::......::|::||..|.|||   ..
Mouse     8 PNQKAKIVENTSTAKTKK--PEAPEPKHVTEPKDSKSVEDPKIPVTDQKEKKTVTTIAEPKDKKS 70

  Fly   151 EAQPQATKAIE-QAPEAPAANAEVQKQV---VDEVKPQEPKIDAKSAEEPAIPAVVAAEKETPVP 211
            |.:|:..|.:. ..|:|.....|..|:.   |.|||.:....|.|   |..|.::...|| .||.
Mouse    71 ETEPKEKKTVTISDPKAKKPAIEKDKRTVTFVTEVKDKRIVTDTK---ENRIASIDTKEK-VPVV 131

  Fly   212 EQPARQERINEIEQKDAKKDAAVAEEPAKAAEATPTAAPEAATKSDSNIQVIAPEKKSIESSPA- 275
            ....:::|:..::.|:  |.|.:...|..:....|.|.|.|.|:..:..:.:||.|.....:|| 
Mouse   132 VPEVKEKRVQLLDPKE--KVAVLPTTPIGSVAHVPHAPPVAHTEHAAPAKPVAPAKPVAPVAPAK 194

  Fly   276 -------------AAAASPAAQAAQAKSGEAPKPVDQQKSTETVAESAPVLKTNAPLAPAGATKV 327
                         .|.|.|.|.||...|.....|.........||.:.||:.. ||:|||.....
Mouse   195 PVAPVAPAKPVVPVAPAKPVAPAAPVTSVVRAVPAAPVTPVAPVAPAVPVVPA-APVAPAAPVVP 258

  Fly   328 TEAVKEQEKEQPAADTA--AKALPEQKKTEETAAPAGAPEPTAAVAPAAVPEAKKIDEAPAAETV 390
            ...|.......|.|..|  |.|||        .|||....|...||| .|||.|:  :.|.:|  
Mouse   259 AAPVAPVAPALPVAPVAPVAPALP--------VAPAVPVAPAVPVAP-VVPEVKQ--KIPVSE-- 310

  Fly   391 VKGEEAIAKPIAQSPSAEPKKSS---EEKSDKSESKVDESSESKESEESS---ESKE 441
            |||::.:  |:......|.|.||   |.|..|..|::.:.:..|:.:|..   |.||
Mouse   311 VKGKKEV--PLRVPELKEIKASSFAPEIKVKKVGSEIKQKAHVKDVKEKKIVPEVKE 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bnbNP_523406.1 PTZ00121 <35..>423 CDD:173412 102/359 (28%)
Akap14NP_001028957.1 AKAP28 408..528 CDD:291158
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.