DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg101 and AT5G66930

DIOPT Version :9

Sequence 1:NP_573326.1 Gene:Atg101 / 32871 FlyBaseID:FBgn0030960 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001154800.1 Gene:AT5G66930 / 836827 AraportID:AT5G66930 Length:251 Species:Arabidopsis thaliana


Alignment Length:219 Identity:47/219 - (21%)
Similarity:86/219 - (39%) Gaps:44/219 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MEGRQVDEAVATIFHTVLFHRCLGKYMYTGDAQYSIGTVGYTDVDCNFIDFTYVCCTSDSLTHKV 76
            :|..::.|.:..|.||::|||.|             |.:...|:|....:.|||.|....:..|:
plant    49 VESFEIREVLRCILHTIVFHRAL-------------GLIRPKDIDLELFEITYVQCGEIEVEKKI 100

  Fly    77 KRAINSFSEKLRSNESCGSGQISLEFFQKKKNR--WPFPQESIPWEVWTVHLDLIK--------- 130
            ...|..|...:..:.:..| ||.|.|::.|..:  |....|.:.||.|.::|::::         
plant   101 DEKIEQFINWIEKHPNKKS-QICLSFYEVKSKQPSWFTKIERLYWEQWYINLNVLQPTKPPVGKS 164

  Fly   131 -------------HENEDERQLCRENVSDLLTEKVIYITELMNRHDYVPKTPSQSELDLIFDTSF 182
                         .|....|.|..:::.::|.:.:.::.|   :.|:||.. :...:...|:.:.
plant   165 HHSKLVMDPGEASEERSSRRTLLEQSLQEVLFQIIKFVNE---KKDHVPPI-NDGVIYYPFEITI 225

  Fly   183 PDVQPYLFKFDY--STSGSAAPSM 204
            |......|..|.  ....|..|||
plant   226 PSSSDSAFGMDMFKRILHSGHPSM 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg101NP_573326.1 ATG101 9..172 CDD:400281 39/183 (21%)
AT5G66930NP_001154800.1 ATG101 49..212 CDD:400281 39/179 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4181
eggNOG 1 0.900 - - E1_KOG4493
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I2601
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1539728at2759
OrthoFinder 1 1.000 - - FOG0005798
OrthoInspector 1 1.000 - - oto3957
orthoMCL 1 0.900 - - OOG6_104431
Panther 1 1.100 - - LDO PTHR13292
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.