DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg101 and atg101

DIOPT Version :9

Sequence 1:NP_573326.1 Gene:Atg101 / 32871 FlyBaseID:FBgn0030960 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001032316.1 Gene:atg101 / 567680 ZFINID:ZDB-GENE-051030-36 Length:218 Species:Danio rerio


Alignment Length:218 Identity:115/218 - (52%)
Similarity:160/218 - (73%) Gaps:0/218 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNARSQVFDLTMEGRQVDEAVATIFHTVLFHRCLGKYMYTGDAQYSIGTVGYTDVDCNFIDFTYV 65
            ||.||:|.::::||||||||:..:.||:|.||..||:.|..:..|||||||..||||:|||||:|
Zfish     1 MNCRSEVLEVSVEGRQVDEAMLGLLHTILLHRSTGKFHYKKEGTYSIGTVGTQDVDCDFIDFTFV 65

  Fly    66 CCTSDSLTHKVKRAINSFSEKLRSNESCGSGQISLEFFQKKKNRWPFPQESIPWEVWTVHLDLIK 130
            ..:||.|...:::|:..|.:.|.::.|.|.|||||||:||||:||||..|.||||||::.::::.
Zfish    66 RVSSDELDRVIRKAVAEFKDALGNSGSDGMGQISLEFYQKKKSRWPFSDECIPWEVWSIKVNVVN 130

  Fly   131 HENEDERQLCRENVSDLLTEKVIYITELMNRHDYVPKTPSQSELDLIFDTSFPDVQPYLFKFDYS 195
            ..||.|||:|||.|.:.|.||||.|.|::|||:|:||.|:|||:|.:||||..||||||:|..|.
Zfish   131 LANEQERQICREKVGEKLGEKVINIVEVINRHEYLPKMPTQSEVDNVFDTSLKDVQPYLYKITYQ 195

  Fly   196 TSGSAAPSMGNAMKKIIKETLAM 218
            .:.|...|:...|:::||:|||:
Zfish   196 ITDSLGTSVSTTMRRLIKDTLAL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg101NP_573326.1 ATG101 9..172 CDD:400281 86/162 (53%)
atg101NP_001032316.1 DUF1649 9..172 CDD:285139 86/162 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580387
Domainoid 1 1.000 194 1.000 Domainoid score I3133
eggNOG 1 0.900 - - E1_KOG4493
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11072
Inparanoid 1 1.050 252 1.000 Inparanoid score I3207
OMA 1 1.010 - - QHG48336
OrthoDB 1 1.010 - - D1539728at2759
OrthoFinder 1 1.000 - - FOG0005798
OrthoInspector 1 1.000 - - oto39885
orthoMCL 1 0.900 - - OOG6_104431
Panther 1 1.100 - - LDO PTHR13292
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R775
SonicParanoid 1 1.000 - - X5518
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.