DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg101 and Atg101

DIOPT Version :9

Sequence 1:NP_573326.1 Gene:Atg101 / 32871 FlyBaseID:FBgn0030960 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001007660.2 Gene:Atg101 / 300240 RGDID:1359310 Length:263 Species:Rattus norvegicus


Alignment Length:218 Identity:111/218 - (50%)
Similarity:156/218 - (71%) Gaps:0/218 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNARSQVFDLTMEGRQVDEAVATIFHTVLFHRCLGKYMYTGDAQYSIGTVGYTDVDCNFIDFTYV 65
            ||.||:|.::::|||||:||:..:.||||.||..||:.|..:..|||||||..||||:|||||||
  Rat    46 MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGIQDVDCDFIDFTYV 110

  Fly    66 CCTSDSLTHKVKRAINSFSEKLRSNESCGSGQISLEFFQKKKNRWPFPQESIPWEVWTVHLDLIK 130
            ..:|:.|...:::.:..|.:.||::...|.||:||||:||||:||||..|.||||||||.:.::.
  Rat   111 RVSSEELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWEVWTVKVHVVA 175

  Fly   131 HENEDERQLCRENVSDLLTEKVIYITELMNRHDYVPKTPSQSELDLIFDTSFPDVQPYLFKFDYS 195
            ...|.|||:|||.|.:.|.||:|.|.|:|:||:|:||.|:|||||.:|||...||||||:|..:.
  Rat   176 LATEQERQICREKVGEKLCEKIINIVEVMSRHEYLPKMPTQSELDNVFDTGLRDVQPYLYKISFQ 240

  Fly   196 TSGSAAPSMGNAMKKIIKETLAM 218
            .:.:...|:...|:::||:|||:
  Rat   241 ITEALGTSVTTTMRRLIKDTLAL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg101NP_573326.1 ATG101 9..172 CDD:400281 84/162 (52%)
Atg101NP_001007660.2 DUF1649 54..217 CDD:285139 84/162 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340591
Domainoid 1 1.000 191 1.000 Domainoid score I3147
eggNOG 1 0.900 - - E1_KOG4493
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11072
Inparanoid 1 1.050 245 1.000 Inparanoid score I3201
OMA 1 1.010 - - QHG48336
OrthoDB 1 1.010 - - D1539728at2759
OrthoFinder 1 1.000 - - FOG0005798
OrthoInspector 1 1.000 - - oto96860
orthoMCL 1 0.900 - - OOG6_104431
Panther 1 1.100 - - LDO PTHR13292
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5518
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.