DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg101 and mug66

DIOPT Version :9

Sequence 1:NP_573326.1 Gene:Atg101 / 32871 FlyBaseID:FBgn0030960 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_593807.1 Gene:mug66 / 2542723 PomBaseID:SPAC25H1.03 Length:184 Species:Schizosaccharomyces pombe


Alignment Length:201 Identity:46/201 - (22%)
Similarity:79/201 - (39%) Gaps:39/201 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EAVATIFHTVLFHRCLGKYMYTGDAQYSIGTVGYTDVDCNFIDFTYVCCTSDSLTHKVKRAINSF 83
            |.|..:...:||||           |:|  ||....:|  .:|.|........|..::......|
pombe    18 EVVKAVLGVILFHR-----------QFS--TVPARTID--VLDITVPTLVGAELNEQLATKAAEF 67

  Fly    84 SEKLRSNESCGSGQISLEFFQKK-KNRWPFPQESIPWEVWTVHLDLIKH-ENEDERQLCRENVSD 146
            .:.:| ||:..:||:.|..:::. |..|.....:||||.|.:|..:::. ::..|..|..|    
pombe    68 IDTIR-NEAGANGQMILLLYERSPKKSWFGKGNTIPWEQWILHTTILEEGDSYQESSLSLE---- 127

  Fly   147 LLTEKVIYITELMNRHDYVPKTPSQSELDLIFDTSFPDVQPYLFKFDYSTSGSAAPSMGNAMKKI 211
            ...|:::....|.:. .|:|.....|           ...||......||.|     .|:.:|::
pombe   128 AAVEQIVQAVNLRSL-SYLPPVAMDS-----------GNYPYEIVTPTSTEG-----WGSLLKRM 175

  Fly   212 IKETLA 217
            |.|.::
pombe   176 IIENVS 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg101NP_573326.1 ATG101 9..172 CDD:400281 36/154 (23%)
mug66NP_593807.1 DUF1649 18..148 CDD:285139 36/150 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4493
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005798
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104431
Panther 1 1.100 - - LDO PTHR13292
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R775
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.