DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6961 and AT5G59950

DIOPT Version :9

Sequence 1:NP_573325.1 Gene:CG6961 / 32869 FlyBaseID:FBgn0030959 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001190572.1 Gene:AT5G59950 / 836117 AraportID:AT5G59950 Length:245 Species:Arabidopsis thaliana


Alignment Length:176 Identity:46/176 - (26%)
Similarity:72/176 - (40%) Gaps:45/176 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 RKAVGGGGGSDSDSGTDSDGDAAAPSKNKRRSPSPLSLR-------------------------- 358
            ||:.||.|.:   .||   |..:.|...:|.:|:..|.|                          
plant    17 RKSRGGAGPA---RGT---GSGSGPGPTRRNNPNRKSTRSAPYQSAKAPESTWGHDMFSDRSEDH 75

  Fly   359 -----TSNTKDGYRLLVSNLHTNVTTADIRELFSDIGPV------YDARVVRPGTAEVIYKSLEH 412
                 ::..:.|.:|.:|||...|...||:|||:::|.:      :|......|||||:|.....
plant    76 RSGRSSAGIETGTKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFDRSGRSKGTAEVVYSRRGD 140

  Fly   413 AEKAVDTYHHRQFDDQPMHCVLVNPHSSRRSVHKASSRTVTTNSSG 458
            |..||..|:..|.|.:||...:|.  ::.::....|.|....||:|
plant   141 ALAAVKKYNDVQLDGKPMKIEIVG--TNLQTAAAPSGRPANGNSNG 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6961NP_573325.1 RRM 256..>443 CDD:223796 41/159 (26%)
RRM_SKAR 366..434 CDD:241125 26/73 (36%)
AT5G59950NP_001190572.1 RRM_THOC4 88..162 CDD:410081 26/73 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19965
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.960

Return to query results.
Submit another query.