DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6961 and AT5G02530

DIOPT Version :9

Sequence 1:NP_573325.1 Gene:CG6961 / 32869 FlyBaseID:FBgn0030959 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_195873.2 Gene:AT5G02530 / 831923 AraportID:AT5G02530 Length:292 Species:Arabidopsis thaliana


Alignment Length:224 Identity:52/224 - (23%)
Similarity:83/224 - (37%) Gaps:76/224 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 DTVSTSKLPESLRSRLFVGKRDPHISHGIYANENRRKAVGGGGGSDSDSGTDSDGDAAAPSKNKR 349
            |.:.:::.|...|.|           .||....|    .||.|||.|:||         ||   |
plant    11 DIIKSNRKPTGSRGR-----------GGIGGGNN----TGGRGGSGSNSG---------PS---R 48

  Fly   350 RSPSPLSLRT-------------------------------------------SNTKDGYRLLVS 371
            |..:.:..||                                           |:.:.|.:|.:|
plant    49 RFANRVGARTAPYSRPIQQQQAHDAMWQNDVFATDASVAAAFGHHQTAVVGGGSSIETGTKLYIS 113

  Fly   372 NLHTNVTTADIRELFSDIGPV------YDARVVRPGTAEVIYKSLEHAEKAVDTYHHRQFDDQPM 430
            ||...|:..||:||||::|.:      ||......|||||::.....|..||..|::.|.|.:.|
plant   114 NLDYGVSNEDIKELFSEVGDLKRYGIHYDRSGRSKGTAEVVFSRRGDALAAVKRYNNVQLDGKLM 178

  Fly   431 HCVLVNPHSSRRSVHKASSRTVTTNSSGV 459
            ...:|..:.|..::...::..:...::|:
plant   179 KIEIVGTNLSAPALPILATAQIPFPTNGI 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6961NP_573325.1 RRM 256..>443 CDD:223796 51/206 (25%)
RRM_SKAR 366..434 CDD:241125 26/73 (36%)
AT5G02530NP_195873.2 RRM_THOC4 108..182 CDD:410081 26/73 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19965
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.960

Return to query results.
Submit another query.