DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6961 and AT3G08000

DIOPT Version :10

Sequence 1:NP_573325.1 Gene:CG6961 / 32869 FlyBaseID:FBgn0030959 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_187457.1 Gene:AT3G08000 / 819991 AraportID:AT3G08000 Length:143 Species:Arabidopsis thaliana


Alignment Length:44 Identity:10/44 - (22%)
Similarity:20/44 - (45%) Gaps:0/44 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 PLSLRTSNTKDGYRLLVSNLHTNVTTADIRELFSDIGPVYDARV 397
            |....:|:.....:|.:..|..:|....:::.||..|.|.:.|:
plant    29 PQFCTSSSASPSSKLFIGGLSWSVDEQSLKDAFSSFGEVAEVRI 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6961NP_573325.1 RRM_SKAR 366..434 CDD:410082 8/32 (25%)
AT3G08000NP_187457.1 RRM 42..124 CDD:440488 8/31 (26%)

Return to query results.
Submit another query.