DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6961 and Gm6763

DIOPT Version :9

Sequence 1:NP_573325.1 Gene:CG6961 / 32869 FlyBaseID:FBgn0030959 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001257828.1 Gene:Gm6763 / 627488 MGIID:3643573 Length:264 Species:Mus musculus


Alignment Length:193 Identity:49/193 - (25%)
Similarity:76/193 - (39%) Gaps:36/193 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 DTVSTSKLPESLRSRLFVGKRDPHISHGIYANENRRKAVGGGGGSDSDSGTDSDGDAAAPSKNKR 349
            |.:..:|:.:....|     .|..::.|..:...|.....||            .:..||....:
Mouse    14 DIIKLTKIQQRRHDR-----PDSRVNRGTGSKRYRPAFTHGG------------RNRLAPYCRPK 61

  Fly   350 RSPSPL-------SLRTSNTKD-GYRLLVSNLHTNVTTADIRELFSDIGPV------YDARVVRP 400
            :.|...       ..|..|..| |.:|.:||||..|:.|||:.||::.|.:      ||......
Mouse    62 QLPDKWQHDLFIGGFRGQNHVDTGGKLFLSNLHFGVSDADIQLLFAEFGTLKKSAVHYDRCGRSL 126

  Fly   401 GTAEVIYKSLEHAEKAVDTYHHRQFDDQPMHCVLVNPHSSRRSVHKASSRT---VTTN-SSGV 459
            |||:|.::....|.||:..|:....|.:||:..|......|:. ..|.|:.   :|.| .|||
Mouse   127 GTAQVHFERKADALKAMREYNGAPLDGRPMNIQLATSQIDRQG-RPAQSKNRGGMTRNPGSGV 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6961NP_573325.1 RRM 256..>443 CDD:223796 42/171 (25%)
RRM_SKAR 366..434 CDD:241125 25/73 (34%)
Gm6763NP_001257828.1 FYTT 6..>59 CDD:284488 10/61 (16%)
RRM <79..>186 CDD:223796 34/107 (32%)
RRM_THOC4 86..160 CDD:241124 25/73 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.