Sequence 1: | NP_573325.1 | Gene: | CG6961 / 32869 | FlyBaseID: | FBgn0030959 | Length: | 474 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001098578.1 | Gene: | alyref / 560127 | ZFINID: | ZDB-GENE-070928-29 | Length: | 280 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 50/196 - (25%) |
---|---|---|---|
Similarity: | 77/196 - (39%) | Gaps: | 55/196 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 263 LTNRLVVGRSNSTKEPLERRHRDTVSTSKLPESLRSRLFVGKRDPHISHGIYANENRRKAVGGGG 327
Fly 328 GSDSDSGTDSDGDAAAPSKNKRRSPSPLSLRTSNTKDGYRLLVSNLHTNVTTADIRELFSDIGPV 392
Fly 393 ------YDARVVRPGTAEVIYKSLEHAEKAVDTYHHRQFDDQPMHCVLVNPH--SSRRSVHKASS 449
Fly 450 R 450 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6961 | NP_573325.1 | RRM | 256..>443 | CDD:223796 | 48/187 (26%) |
RRM_SKAR | 366..434 | CDD:241125 | 27/73 (37%) | ||
alyref | NP_001098578.1 | RRM | <126..>226 | CDD:223796 | 32/92 (35%) |
RRM_THOC4 | 126..199 | CDD:241124 | 27/72 (38%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0533 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |