DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6961 and Alyref2

DIOPT Version :9

Sequence 1:NP_573325.1 Gene:CG6961 / 32869 FlyBaseID:FBgn0030959 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_062357.3 Gene:Alyref2 / 56009 MGIID:1913144 Length:218 Species:Mus musculus


Alignment Length:172 Identity:50/172 - (29%)
Similarity:73/172 - (42%) Gaps:18/172 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 KRDPHISHGIYANENRRKAVGGGGGSDSDSGTDSDGDAAAPSKNKRRSPSPLSLR---------- 358
            |.|..:...|..|.|:|: |..|||...:....:.|....|:...|..|.|...:          
Mouse     4 KMDMSLDDIIKLNRNQRR-VNRGGGPRRNRPAIARGGRNRPAPYSRPKPLPDKWQHDLFDSGCGG 67

  Fly   359 TSNTKDGYRLLVSNLHTNVTTADIRELFSDIGPV------YDARVVRPGTAEVIYKSLEHAEKAV 417
            ....:.|.:||||||...|:.|||:|||::.|.:      ||......|||:|.::....|.||:
Mouse    68 GEGVETGAKLLVSNLDFGVSDADIQELFAEFGTLKKAAVDYDRSGRSLGTADVHFERRADALKAM 132

  Fly   418 DTYHHRQFDDQPMHCVLVNPH-SSRRSVHKASSRTVTTNSSG 458
            ..|.....|.:||...||... ..:|...::.:|...|.|.|
Mouse   133 KQYKGVPLDGRPMDIQLVTSQIDPQRRPAQSGNRGGMTRSRG 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6961NP_573325.1 RRM 256..>443 CDD:223796 45/155 (29%)
RRM_SKAR 366..434 CDD:241125 27/73 (37%)
Alyref2NP_062357.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55 15/51 (29%)
FYTT 3..>32 CDD:284488 10/28 (36%)
Sufficient for RNA-binding, interaction with NXF1-NXT1 16..37 7/21 (33%)
Interaction with HHV-8 ORF57 protein and with ICP27 from HHV-1 54..155 30/100 (30%)
RRM <75..>157 CDD:223796 29/81 (36%)
RRM_THOC4 75..149 CDD:241124 27/73 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..218 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.