DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6961 and alyref

DIOPT Version :9

Sequence 1:NP_573325.1 Gene:CG6961 / 32869 FlyBaseID:FBgn0030959 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001017027.1 Gene:alyref / 549781 XenbaseID:XB-GENE-973553 Length:260 Species:Xenopus tropicalis


Alignment Length:205 Identity:54/205 - (26%)
Similarity:78/205 - (38%) Gaps:57/205 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 KRDPHISHGIYANENRRKAVGGGGGSDSDSGTDSDGDA------------------AAPSKNK-- 348
            |.|..:...|..|.::|.|..|.||.....|..:.|.|                  ..|.:::  
 Frog     4 KMDMSLDDIIKLNRSQRPAGRGRGGGRGARGGSARGGAGGRIGGGRGGGGGGAAGGGGPMRSRPV 68

  Fly   349 -----RRSPSPLSLRTSNTKD-------------------GYRLLVSNLHTNVTTADIRELFSDI 389
                 |..|:|.| |.....|                   |.:||||||...|:.|||:|||::.
 Frog    69 LTRGGRNRPAPYS-RPKQLPDKWQHDLFDSGFGTGAGMETGGKLLVSNLDFGVSDADIQELFAEF 132

  Fly   390 GPV------YDARVVRPGTAEVIYKSLEHAEKAVDTYHHRQFDDQPMHCVLVNPHSSRRSVHKAS 448
            |.:      ||......|||:|.::....|.||:..|:....|.:||:..||.      |..:|.
 Frog   133 GTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVT------SQIEAQ 191

  Fly   449 SRTVTTNSSG 458
            .|.:.:.|.|
 Frog   192 RRPIQSQSRG 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6961NP_573325.1 RRM 256..>443 CDD:223796 49/188 (26%)
RRM_SKAR 366..434 CDD:241125 27/73 (37%)
alyrefNP_001017027.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89 18/85 (21%)
RRM_THOC4 109..183 CDD:241124 27/73 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..260 4/13 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.