DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6961 and Ref2

DIOPT Version :9

Sequence 1:NP_573325.1 Gene:CG6961 / 32869 FlyBaseID:FBgn0030959 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001246007.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster


Alignment Length:181 Identity:42/181 - (23%)
Similarity:69/181 - (38%) Gaps:35/181 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 FVGKRDPHISHGIYANENRRKAVGG-GGGSDSDSGTDSDGDAAAPSKNKRRSPSPLSLRTSNTKD 364
            ||..::..:..|   :..:|.:.|| .|...|.:||.....:....:...:.|...:|       
  Fly    22 FVNAKNERVQGG---SIRKRNSEGGLRGIQRSRNGTGFIRKSKFKQETLLKPPKKPTL------- 76

  Fly   365 GYRLLVSNLHTNVTTADIRELFSDIGPV------YDARVVRPGTAEVIYKSLEHAEKAVDTYHHR 423
               ::|.||...|...||.|||:..|.|      ||......|||.:.:|..|.|.:.::.:|..
  Fly    77 ---VMVCNLDYGVDDDDIMELFNQDGVVEKGFVHYDRDGNSLGTAHLSFKYREEAFQIIEQFHGV 138

  Fly   424 QFDDQPMHCVLVNPHSSRRSVHKASSRTVTTNSSGVEVDIDALHSVLFRAR 474
            :.|.:            |..:|...:   |.|....:||..:|....|:.|
  Fly   139 RLDGR------------RLKLHLVQN---TRNFKRTDVDDLSLRMGSFKTR 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6961NP_573325.1 RRM 256..>443 CDD:223796 34/148 (23%)
RRM_SKAR 366..434 CDD:241125 21/73 (29%)
Ref2NP_001246007.1 RRM 2..>198 CDD:223796 42/181 (23%)
RRM_SF 75..149 CDD:302621 23/95 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0533
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19965
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.