DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6961 and mlo3

DIOPT Version :9

Sequence 1:NP_573325.1 Gene:CG6961 / 32869 FlyBaseID:FBgn0030959 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_595715.1 Gene:mlo3 / 2540565 PomBaseID:SPBC1D7.04 Length:199 Species:Schizosaccharomyces pombe


Alignment Length:130 Identity:36/130 - (27%)
Similarity:62/130 - (47%) Gaps:13/130 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   344 PSKNKRRSPSPLSLRTSNTKDGYRLLVSNLHTNVTTADIRELF-SDIGP------VYDARVVRPG 401
            |:||.:.:.:..|...|...:..:::||||.|:||.|.::||| ..|||      .|.......|
pombe    33 PTKNAKPAVNTASALKSVISEESKIIVSNLPTDVTEAQVKELFVKSIGPCKRVSLAYGPNGRSKG 97

  Fly   402 TAEVIYKSLEHAEKAVDTYHHRQFD-DQPMHC-VLVNP----HSSRRSVHKASSRTVTTNSSGVE 460
            .|.:|:.....|.:|.:.|..|..| .:.|.. ::::|    :|....|..||:.:.|.:.:|.:
pombe    98 IATIIFSRPGDATRAYEQYEGRLVDGTRKMKVEIILDPSRQLNSLAARVSPASNASATASKNGAK 162

  Fly   461  460
            pombe   163  162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6961NP_573325.1 RRM 256..>443 CDD:223796 31/111 (28%)
RRM_SKAR 366..434 CDD:241125 24/76 (32%)
mlo3NP_595715.1 RRM <2..196 CDD:223796 36/130 (28%)
RRM_YRA1_MLO3 56..132 CDD:240713 24/75 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR19965
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.