DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6961 and aly-2

DIOPT Version :9

Sequence 1:NP_573325.1 Gene:CG6961 / 32869 FlyBaseID:FBgn0030959 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_501594.1 Gene:aly-2 / 177738 WormBaseID:WBGene00000121 Length:227 Species:Caenorhabditis elegans


Alignment Length:158 Identity:36/158 - (22%)
Similarity:63/158 - (39%) Gaps:26/158 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 DPHISHGIYANENRRKAV------GGGG----GSDSDSGT---DSDGDAAAPSK---NKRRSPSP 354
            |..:|..|..|...:|.|      ..||    |:.|:.||   .|.|.:....:   ..|||.. 
 Worm     8 DMSLSDIISTNRKNKKVVKKPIKKSAGGIRKRGNASNVGTPRRQSGGTSRGGGRMGNTVRRSAG- 71

  Fly   355 LSLRTSNTKDGYRLLVSNLHTNVTTADIRELFS-----DIGPVYDARVVRPGTAEVIYKSLEHAE 414
               .:||.....|:.:|||...|.::|::|||.     .:...::......||.::..|..: |:
 Worm    72 ---GSSNDNKQVRINISNLAETVISSDLQELFGAFNLHKVSVNFNENGGAAGTGDITLKKYD-AD 132

  Fly   415 KAVDTYHHRQFDDQPMHCVLVNPHSSRR 442
            :.:..:.....|.:.||..::...:..|
 Worm   133 RLIQKFAGVALDGKVMHFAVIESSNFAR 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6961NP_573325.1 RRM 256..>443 CDD:223796 36/158 (23%)
RRM_SKAR 366..434 CDD:241125 16/72 (22%)
aly-2NP_501594.1 RRM_SF 81..152 CDD:388407 16/71 (23%)
FoP_duplication 165..>227 CDD:372765
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165197
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.