DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6961 and ALYREF

DIOPT Version :9

Sequence 1:NP_573325.1 Gene:CG6961 / 32869 FlyBaseID:FBgn0030959 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_005773.3 Gene:ALYREF / 10189 HGNCID:19071 Length:264 Species:Homo sapiens


Alignment Length:213 Identity:58/213 - (27%)
Similarity:84/213 - (39%) Gaps:52/213 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 LPESLRSRLFVGKRDPHISHGIYANENRRKAVGGG---GGSDSDSGTDSDGDAAA-------PSK 346
            :|:|  :.....|.|..:...|..|.::|...|||   |.:.|..|......|||       |.:
Human     1 MPDS--APAMADKMDMSLDDIIKLNRSQRGGRGGGRGRGRAGSQGGRGGGAQAAARVNRGGGPIR 63

  Fly   347 NK------------RRSPSPLSLRTSNTKD-------------------GYRLLVSNLHTNVTTA 380
            |:            |..|:|.| |.....|                   |.:||||||...|:.|
Human    64 NRPAIARGAAGGGGRNRPAPYS-RPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNLDFGVSDA 127

  Fly   381 DIRELFSDIGPV------YDARVVRPGTAEVIYKSLEHAEKAVDTYHHRQFDDQPMHCVLVNPH- 438
            ||:|||::.|.:      ||......|||:|.::....|.||:..|:....|.:||:..||... 
Human   128 DIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTSQI 192

  Fly   439 -SSRRSVHKASSRTVTTN 455
             :.||.....:...:|.|
Human   193 DAQRRPAQSVNRGGMTRN 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6961NP_573325.1 RRM 256..>443 CDD:223796 55/199 (28%)
RRM_SKAR 366..434 CDD:241125 27/73 (37%)
ALYREFNP_005773.3 FYTT 4..>23 CDD:284488 4/20 (20%)
RRM <114..>210 CDD:223796 32/95 (34%)
RRM_THOC4 114..187 CDD:241124 27/72 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.