DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18259 and SC35

DIOPT Version :10

Sequence 1:NP_573324.1 Gene:CG18259 / 32866 FlyBaseID:FBgn0030956 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_201225.1 Gene:SC35 / 836541 AraportID:AT5G64200 Length:303 Species:Arabidopsis thaliana


Alignment Length:126 Identity:35/126 - (27%)
Similarity:48/126 - (38%) Gaps:30/126 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 RRSPSPLSLRTSNTKDGYRLLVSNLHTNVTTADIRELFSDIGPVYDARVVRP-------GTAEVI 406
            |..|..:|       |.|.|||.|:....|..|:..||:..|.|.|..:.|.       |.|.|.
plant     6 RSGPPDIS-------DTYSLLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTGDSRGFAFVR 63

  Fly   407 YKSLEHAEKAVDTYHHRQFDDQPMHC----------------VLVNPHSSRRSVHKASSRT 451
            ||..:.|.|||:....|..|.:.:..                |:..|..||||..::..|:
plant    64 YKYKDEAHKAVERLDGRVVDGREITVQFAKYGPNAEKISKGRVVEPPPKSRRSRSRSPRRS 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18259NP_573324.1 RRM_SKAR 366..434 CDD:410082 24/90 (27%)
SC35NP_201225.1 RRM_SRSF2_SRSF8 18..90 CDD:409751 23/71 (32%)
PHA03307 <204..>303 CDD:223039
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.