DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18259 and ALY4

DIOPT Version :9

Sequence 1:NP_573324.1 Gene:CG18259 / 32866 FlyBaseID:FBgn0030956 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_198588.2 Gene:ALY4 / 833750 AraportID:AT5G37720 Length:288 Species:Arabidopsis thaliana


Alignment Length:192 Identity:54/192 - (28%)
Similarity:71/192 - (36%) Gaps:55/192 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 RRKAVGGGG---ARDSDSGTDSDGDAAAPSKNKRRSPSPLSLR---------------------- 358
            |.|....||   :|....|....|..|.|:   ||.|..::.|                      
plant    15 RGKTARSGGRGISRGRGRGRGGGGRGAGPA---RRGPLAVNARPSSFTINKPVRRVRSLPWQSGL 76

  Fly   359 ---------TSNTKDGYRLLVSNLHTNVTTADIRELFSDIGPV------YDARVVRPGTAEVIYK 408
                     .|..:.|.||.|:||...||..|||||||:||.|      ||......|||||:|.
plant    77 FEDGLRAAGASGVEVGTRLHVTNLDQGVTNEDIRELFSEIGEVERYAIHYDKNGRPSGTAEVVYP 141

  Fly   409 SLEHAEKAVDTYHHRQFDDQPMHCVLVN-------PHSSRRSVHKAS-----SRTVTTNSSG 458
            ....|.:|:..|::...|.:||...::.       |.|.|.:|:...     .|||.....|
plant   142 RRSDAFQALKKYNNVLLDGRPMRLEILGGNNSSEAPLSGRVNVNVTGLNGRLKRTVVIQQGG 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18259NP_573324.1 RRM <345..>443 CDD:223796 40/141 (28%)
RRM_SKAR 366..434 CDD:241125 31/73 (42%)
ALY4NP_198588.2 RRM_THOC4 93..167 CDD:410081 31/73 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19965
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.