DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18259 and AT5G02530

DIOPT Version :9

Sequence 1:NP_573324.1 Gene:CG18259 / 32866 FlyBaseID:FBgn0030956 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_195873.2 Gene:AT5G02530 / 831923 AraportID:AT5G02530 Length:292 Species:Arabidopsis thaliana


Alignment Length:204 Identity:47/204 - (23%)
Similarity:77/204 - (37%) Gaps:62/204 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 RDPHISHGIYANENRRKAVGGGGARDSDSGTDSDGDAAAPSKNKRRSPSPLSLRT---------- 359
            |.|..|.|       |..:|||   ::..|....|..:.||   ||..:.:..||          
plant    17 RKPTGSRG-------RGGIGGG---NNTGGRGGSGSNSGPS---RRFANRVGARTAPYSRPIQQQ 68

  Fly   360 ---------------------------------SNTKDGYRLLVSNLHTNVTTADIRELFSDIGP 391
                                             |:.:.|.:|.:|||...|:..||:||||::|.
plant    69 QAHDAMWQNDVFATDASVAAAFGHHQTAVVGGGSSIETGTKLYISNLDYGVSNEDIKELFSEVGD 133

  Fly   392 V------YDARVVRPGTAEVIYKSLEHAEKAVDTYHHRQFDDQPMHCVLVNPHSSRRSVHKASSR 450
            :      ||......|||||::.....|..||..|::.|.|.:.|...:|..:.|..::...::.
plant   134 LKRYGIHYDRSGRSKGTAEVVFSRRGDALAAVKRYNNVQLDGKLMKIEIVGTNLSAPALPILATA 198

  Fly   451 TVTTNSSGV 459
            .:...::|:
plant   199 QIPFPTNGI 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18259NP_573324.1 RRM <345..>443 CDD:223796 35/146 (24%)
RRM_SKAR 366..434 CDD:241125 26/73 (36%)
AT5G02530NP_195873.2 RRM_THOC4 108..182 CDD:410081 26/73 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19965
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.960

Return to query results.
Submit another query.