DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18259 and alyref

DIOPT Version :9

Sequence 1:NP_573324.1 Gene:CG18259 / 32866 FlyBaseID:FBgn0030956 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001098578.1 Gene:alyref / 560127 ZFINID:ZDB-GENE-070928-29 Length:280 Species:Danio rerio


Alignment Length:196 Identity:48/196 - (24%)
Similarity:76/196 - (38%) Gaps:55/196 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 LTNRLVVGRSNTTKEPLERRHRDTASTSKLPESLRSRLFVGKRDPHISHGIYANENRRKAVGGGG 327
            :.||..:.|..:...|..|       ..:||:..:             |.::.|.....|.||||
Zfish    69 MRNRQNLSRGRSRPAPYSR-------PKQLPDKWQ-------------HDLFDNGYSSNAGGGGG 113

  Fly   328 ARDSDSGTDSDGDAAAPSKNKRRSPSPLSLRTSNTKDGYRLLVSNLHTNVTTADIRELFSDIGPV 392
            .....:|.::.|                           :||||||...|:.|||:|||::.|.:
Zfish   114 GGGGGAGVETGG---------------------------KLLVSNLDFGVSDADIQELFAEFGTL 151

  Fly   393 ------YDARVVRPGTAEVIYKSLEHAEKAVDTYHHRQFDDQPMHCVLVNPH--SSRRSVHKASS 449
                  ||......|||:|.::....|.||:..|:....|.:||:..||...  :.||:..:..:
Zfish   152 KKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTSQIDAQRRTPMQGLN 216

  Fly   450 R 450
            |
Zfish   217 R 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18259NP_573324.1 RRM <345..>443 CDD:223796 30/105 (29%)
RRM_SKAR 366..434 CDD:241125 27/73 (37%)
alyrefNP_001098578.1 RRM <126..>226 CDD:223796 32/92 (35%)
RRM_THOC4 126..199 CDD:241124 27/72 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.