DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18259 and Ref1

DIOPT Version :10

Sequence 1:NP_573324.1 Gene:CG18259 / 32866 FlyBaseID:FBgn0030956 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster


Alignment Length:126 Identity:38/126 - (30%)
Similarity:53/126 - (42%) Gaps:43/126 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 HGIYANENRRKAVGGGGARDSDSGTDSDGDAAAPSKNKRRSPSPLSLRTSNTKDGYRLLVSNLHT 375
            |.:| :..:|.|||||               :.|:                     ||:|.||..
  Fly    91 HDMY-DGPKRGAVGGG---------------SGPT---------------------RLIVGNLDY 118

  Fly   376 NVTTADIRELFSDIGPV------YDARVVRPGTAEVIYKSLEHAEKAVDTYHHRQFDDQPM 430
            .|:..||:|||:|.||:      ||......|||:||::....|.||:..||....|.:||
  Fly   119 GVSNTDIKELFNDFGPIKKAAVHYDRSGRSLGTADVIFERRADALKAIKQYHGVPLDGRPM 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18259NP_573324.1 RRM_SKAR 366..434 CDD:410082 29/71 (41%)
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 38/126 (30%)
RRM_THOC4 109..183 CDD:410081 29/92 (32%)
FoP_duplication 202..>260 CDD:464005
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.