DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18259 and rbm7

DIOPT Version :10

Sequence 1:NP_573324.1 Gene:CG18259 / 32866 FlyBaseID:FBgn0030956 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_956219.1 Gene:rbm7 / 334784 ZFINID:ZDB-GENE-030131-6724 Length:252 Species:Danio rerio


Alignment Length:30 Identity:12/30 - (40%)
Similarity:15/30 - (50%) Gaps:0/30 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 LLVSNLHTNVTTADIRELFSDIGPVYDARV 397
            |.|.||...||...|.|||...||:...::
Zfish    11 LFVGNLDPQVTEEVIFELFLQAGPLIKVKI 40

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18259NP_573324.1 RRM_SKAR 366..434 CDD:410082 12/30 (40%)
rbm7NP_956219.1 RRM_RBM7 8..82 CDD:410005 12/30 (40%)
PABP-1234 <11..195 CDD:130689 12/30 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..137
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..252
PRK12678 <171..>248 CDD:237171
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.