DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18259 and aly-1

DIOPT Version :9

Sequence 1:NP_573324.1 Gene:CG18259 / 32866 FlyBaseID:FBgn0030956 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_501588.1 Gene:aly-1 / 177735 WormBaseID:WBGene00000120 Length:223 Species:Caenorhabditis elegans


Alignment Length:166 Identity:39/166 - (23%)
Similarity:69/166 - (41%) Gaps:38/166 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 DPHISHGIYANEN---RRKAVGGGGARDSDSGTDSDGDAAAPSKNKRRSPSPLSLRT------SN 361
            |..:|.||...:.   :|.:|||...|.|   |.:.|.:..|:...||...  .:||      :|
 Worm     8 DAPLSAGIRRTKKSPIKRASVGGVKKRFS---TGTAGPSRRPTAQPRRQSG--GIRTVDRSIPAN 67

  Fly   362 TKDGYRLLVSNLHTNVTTADIRELFSDIGPVYDARVV--------RP-GTAEVIYKSLEHAEKAV 417
            .....|:.:|||...|.:.|:|:||::    :..|.|        :| ||.:|.... .||::.:
 Worm    68 ENREVRINLSNLAHTVHSGDLRQLFAE----FKIRNVSVNFNEHGKPVGTGDVTLPK-RHADRLI 127

  Fly   418 DTYHHRQFDDQPMHCVLVN----------PHSSRRS 443
            ..:.....|.:.:...:::          |.:.||:
 Worm   128 QKFAGVSLDGKEIKFAIIDSANIANRVKFPEAPRRA 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18259NP_573324.1 RRM <345..>443 CDD:223796 25/122 (20%)
RRM_SKAR 366..434 CDD:241125 18/76 (24%)
aly-1NP_501588.1 RRM_SF 73..144 CDD:388407 18/75 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.