DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18259 and C02B10.4

DIOPT Version :9

Sequence 1:NP_573324.1 Gene:CG18259 / 32866 FlyBaseID:FBgn0030956 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_500722.1 Gene:C02B10.4 / 177283 WormBaseID:WBGene00015329 Length:211 Species:Caenorhabditis elegans


Alignment Length:132 Identity:33/132 - (25%)
Similarity:52/132 - (39%) Gaps:30/132 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 RRSPSPLSLRTSNTKDGYRLLVSNLHTNVTTADIRELFSDIGPVYDARVVR---------PGTAE 404
            |...:|..:|..:|... .|::.||.|.||..|:.|||..    |:..:|:         .|.|:
 Worm    77 RGRTAPAVVREIHTGPS-TLIIKNLATTVTQEDLEELFEQ----YEPELVQLHYGPTGESNGCAD 136

  Fly   405 VIYKSLEHAEKAV--DTYHHRQFDDQPMHCVLVNPHS-----------SRRSVHKASSRTVTTNS 456
            :|   :.||:.|:  ........|.:|:..:..||..           ||.:..||.:..|...|
 Worm   137 LI---VPHAQVAIIQKALEGVLLDGEPIEVLEANPPKQVSVFDRIKKVSRGNDFKAKNMRVVVKS 198

  Fly   457 SG 458
            .|
 Worm   199 KG 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18259NP_573324.1 RRM <345..>443 CDD:223796 28/115 (24%)
RRM_SKAR 366..434 CDD:241125 20/78 (26%)
C02B10.4NP_500722.1 RRM_Aly_REF_like 93..163 CDD:240864 20/77 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.