DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18259 and Gm4340

DIOPT Version :9

Sequence 1:NP_573324.1 Gene:CG18259 / 32866 FlyBaseID:FBgn0030956 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001171006.1 Gene:Gm4340 / 100043292 MGIID:3782524 Length:268 Species:Mus musculus


Alignment Length:192 Identity:52/192 - (27%)
Similarity:78/192 - (40%) Gaps:23/192 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 TASTSKLPESLRSRLFVGKRDPHISHGIYANENRRKAVGGGGARDSDSGTDSDGDAAAPSKNKRR 350
            |....|:..||...:.:.|    |....:...:.|...|.|..|...:.|....:..||....::
Mouse     2 TTMADKMDMSLEDIIKLTK----IQQRRHDRPDSRVNRGTGSKRYRPAFTHGGRNRLAPYCRPKQ 62

  Fly   351 SPSPL-------SLRTSNTKD-GYRLLVSNLHTNVTTADIRELFSDIGPV------YDARVVRPG 401
            .|...       ..|..|..| |.:|.:||||..|:.|||:.||::.|.:      ||......|
Mouse    63 LPDKWQHDLFIGGFRGQNHVDTGGKLFLSNLHFGVSDADIQLLFAEFGTLKKSAVHYDRCGRSLG 127

  Fly   402 TAEVIYKSLEHAEKAVDTYHHRQFDDQPMHCVLVNPHSSRRSVHKASSRT---VTTN-SSGV 459
            ||:|.::....|.||:..|:....|.:||:..|......|:. ..|.|:.   :|.| .|||
Mouse   128 TAQVHFERKADALKAMREYNGAPLDGRPMNIQLATSQIDRQG-RPAQSKNRGGMTRNPGSGV 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18259NP_573324.1 RRM <345..>443 CDD:223796 32/111 (29%)
RRM_SKAR 366..434 CDD:241125 25/73 (34%)
Gm4340NP_001171006.1 FYTT 6..>59 CDD:284488 12/56 (21%)
RRM <79..>186 CDD:223796 34/107 (32%)
RRM_THOC4 86..160 CDD:241124 25/73 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.