Sequence 1: | NP_573324.1 | Gene: | CG18259 / 32866 | FlyBaseID: | FBgn0030956 | Length: | 474 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001160111.1 | Gene: | Gm4305 / 100043235 | MGIID: | 3782485 | Length: | 289 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 53/196 - (27%) |
---|---|---|---|
Similarity: | 78/196 - (39%) | Gaps: | 31/196 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 286 TASTSKLPESLR-----SRLFVGKRDPHISHGIYANENRRKAVGGGGARDSDSGTDSDGDAAAPS 345
Fly 346 KNKRRSPSPL-------SLRTSNTKD-GYRLLVSNLHTNVTTADIRELFSDIGPV------YDAR 396
Fly 397 VVRPGTAEVIYKSLEHAEKAVDTYHHRQFDDQPMHCVLVNPHSSR--RSVHKASSRTVTTN-SSG 458
Fly 459 V 459 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18259 | NP_573324.1 | RRM | <345..>443 | CDD:223796 | 33/113 (29%) |
RRM_SKAR | 366..434 | CDD:241125 | 25/73 (34%) | ||
Gm4305 | NP_001160111.1 | FYTT | 6..>59 | CDD:284488 | 13/61 (21%) |
RRM | <79..>163 | CDD:223796 | 30/83 (36%) | ||
RRM_THOC4 | 86..160 | CDD:241124 | 25/73 (34%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |