DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6891 and Cortactin

DIOPT Version :10

Sequence 1:NP_573323.1 Gene:CG6891 / 32865 FlyBaseID:FBgn0030955 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_524426.2 Gene:Cortactin / 42491 FlyBaseID:FBgn0025865 Length:559 Species:Drosophila melanogaster


Alignment Length:116 Identity:22/116 - (18%)
Similarity:45/116 - (38%) Gaps:31/116 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ATSLEKDSIREAYE----DVRSDLTDTEWAVFKFDG-------------------AQIIVHARGQ 62
            |.:::.|.:||..|    |.:..|...:.|.:.:.|                   .::..||..:
  Fly    52 AGTIDMDKLREETEQADLDKKKQLLKDQNAGYGYGGKFGVEKDRMDKSAVGHDYQGKVGKHASQK 116

  Fly    63 CFEE-FRQQFGDSE-----RAFGYIRIQMGDEMSKRKKFIFLTWIGQEVGV 107
            .:.: |..:||..|     .|.|:..::..::.:.:|.  :.|..|.:.||
  Fly   117 DYSDGFGGKFGVQEDRKDKSAVGWDHVEKVEKHASQKD--YATGFGGKFGV 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6891NP_573323.1 ADF_coactosin_like 28..139 CDD:200438 20/109 (18%)
CortactinNP_524426.2 HS1_rep 84..119 CDD:460497 3/34 (9%)
HS1_rep 121..156 CDD:460497 7/36 (19%)
HS1_rep 158..193 CDD:460497 3/8 (38%)
HS1_rep 195..230 CDD:460497
rne <327..489 CDD:236766
SH3_Cortactin 502..554 CDD:212892
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.