DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCKLR-17D3 and TkR86C

DIOPT Version :9

Sequence 1:NP_001097023.1 Gene:CCKLR-17D3 / 32864 FlyBaseID:FBgn0030954 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster


Alignment Length:451 Identity:107/451 - (23%)
Similarity:171/451 - (37%) Gaps:144/451 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 DDRDGYMD-TEPSDLVTELAFSLGTSSSPSPSSTPASSSSTSTGMPVWLIPSYSMILLFAVLGNL 130
            |:||.... .|..|.:||..|       |||:..........|   :|.| .:.:::..|:.||.
  Fly    49 DNRDNLESINEAKDFLTECLF-------PSPTRPYELPWEQKT---IWAI-IFGLMMFVAIAGNG 102

  Fly   131 LVISTLVQNRRMRTITNVFLLNLAISDMLLGVLCMPVTLVGTLLRNFIFGEFLCKLFQFSQAASV 195
            :|:..:..:|.|||:||.|||||:|:|:|:..|......:..|..::.||...|.:..|....:|
  Fly   103 IVLWIVTGHRSMRTVTNYFLLNLSIADLLMSSLNCVFNFIFMLNSDWPFGSIYCTINNFVANVTV 167

  Fly   196 AVSSWTLVAISCERYYAICHPLRSRSWQTISHAYKII-GFIWLGGILCMTPIAVFSQLIP----- 254
            :.|.:||||||.:||.||.|||:.|   |.....:|| ..||....:...|..::|.::.     
  Fly   168 STSVFTLVAISFDRYIAIVHPLKRR---TSRRKVRIILVLIWALSCVLSAPCLLYSSIMTKHYYN 229

  Fly   255 -TSRPGYCKCREFWPDQGY-----ELFYNILLDFLLLVLPLLVLCVAYILITRTLYVGMAKDSGR 313
             .||   ..|...|||..|     :..||:::..|...:|::|:.:.|.|:.|.|:         
  Fly   230 GKSR---TVCFMMWPDGRYPTSMADYAYNLIILVLTYGIPMIVMLICYSLMGRVLW--------- 282

  Fly   314 ILQQSLPVSATTAGGSAPNPGTSSSSNCILVLTATAVYNENSNNNNGNSEGSAGGGSTNMATTTL 378
                                                                   ||.::...| 
  Fly   283 -------------------------------------------------------GSRSIGENT- 291

  Fly   379 TTRPTAPTVITTTTTTTVTLAKTSSPSIRVHDAALRRSNEAKTLESKKRVVKMLFVLVLEFFICW 443
                                                 ..:.::::||::||:|...:|..|.|||
  Fly   292 -------------------------------------DRQMESMKSKRKVVRMFIAIVSIFAICW 319

  Fly   444 TPLYVI------NTMVMLIGPVVYEYVDYTAISFLQLLAYSSSCCNPITYCFMNASFRRAF 498
            .|.::.      |..|     ...:||.:..:.| ..||.|::..||:.|.:||..||..|
  Fly   320 LPYHLFFIYAYHNNQV-----ASTKYVQHMYLGF-YWLAMSNAMVNPLIYYWMNKRFRMYF 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCKLR-17D3NP_001097023.1 7tm_4 120..>244 CDD:304433 45/124 (36%)
7tm_1 128..487 CDD:278431 86/376 (23%)
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 93/397 (23%)
7tm_1 100..363 CDD:278431 86/376 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24238
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.