DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCKLR-17D3 and AkhR

DIOPT Version :9

Sequence 1:NP_001097023.1 Gene:CCKLR-17D3 / 32864 FlyBaseID:FBgn0030954 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_995639.1 Gene:AkhR / 33942 FlyBaseID:FBgn0025595 Length:455 Species:Drosophila melanogaster


Alignment Length:392 Identity:87/392 - (22%)
Similarity:148/392 - (37%) Gaps:125/392 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 IPSYSMILLFAVLGNLLVISTLVQNRRMR--TITNVFLLNLAISDMLLGVLCMPVTLVGTLLRNF 177
            |..||::.:.:.:||..|: .|:..||:|  ...::.|::|||:|:::.:|.||:.:|......:
  Fly    42 ITVYSILFVISTIGNSTVL-YLLTKRRLRGPLRIDIMLMHLAIADLMVTLLLMPMEIVWAWTVQW 105

  Fly   178 IFGEFLCKLFQFSQAASVAVSSWTLVAISCERYYAICHPLRSRSWQTISHAYKIIGFIWLGGILC 242
            :..:.:|:|..|.:...:.:||:.:|.||.:||:||..||: ||:   :....::...|||.::|
  Fly   106 LSTDLMCRLMSFFRVFGLYLSSYVMVCISLDRYFAILKPLK-RSY---NRGRIMLACAWLGSVVC 166

  Fly   243 MTPIAVFSQLIPTSRP---GYCKC---REFWPDQGYELFYNILLDFLLLVLPLLVLCVAYILITR 301
            ..|.|....|  ...|   ||.:|   ..|..|.. |..|.......:...||::....|    .
  Fly   167 SIPQAFLFHL--EEHPAVTGYFQCVIFNSFRSDFD-EKLYQAASMCSMYAFPLIMFIYCY----G 224

  Fly   302 TLYVGMAKDSGRILQQSLPVSATTAGGSAPNPGTSSSSNCILVLTATAVYNENSNNNNGNSEGSA 366
            .:|:.:.:.|.|:|:.                                                 
  Fly   225 AIYLEIYRKSQRVLKD------------------------------------------------- 240

  Fly   367 GGGSTNMATTTLTTRPTAPTVITTTTTTTVTLAKTSSPSIRVHDAALRRSNEAKTLESKKRVVKM 431
                                                     |.....||||:.....:|||.:||
  Fly   241 -----------------------------------------VIAERFRRSNDDVLSRAKKRTLKM 264

  Fly   432 LFVLVLEFFICWTPLYVINTMVML-------IGPVVYEYVDYTAISFLQLLAYSSSCCNPITYCF 489
            ...:|:.|.|||||.|.|:....|       |.|::.:        .|.:.|.::||.||:.|..
  Fly   265 TITIVIVFIICWTPYYTISMWYWLDKHSAGKINPLLRK--------ALFIFASTNSCMNPLVYGL 321

  Fly   490 MN 491
            .|
  Fly   322 YN 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCKLR-17D3NP_001097023.1 7tm_4 120..>244 CDD:304433 36/125 (29%)
7tm_1 128..487 CDD:278431 82/373 (22%)
AkhRNP_995639.1 7tm_1 55..319 CDD:278431 82/373 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472993
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.