| Sequence 1: | NP_001097023.1 | Gene: | CCKLR-17D3 / 32864 | FlyBaseID: | FBgn0030954 | Length: | 584 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_061497177.1 | Gene: | LOC1281799 / 1281799 | VectorBaseID: | AGAMI1_009161 | Length: | 472 | Species: | Anopheles gambiae |
| Alignment Length: | 48 | Identity: | 11/48 - (22%) |
|---|---|---|---|
| Similarity: | 18/48 - (37%) | Gaps: | 10/48 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 184 PGWMPFTNCHRFSENSTKISIDFQINRLFGSTLIYEIDLLIEGVLLEL 231 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CCKLR-17D3 | NP_001097023.1 | 7tm_GPCRs | 112..498 | CDD:475119 | 11/48 (23%) |
| TM helix 1 | 114..138 | CDD:320334 | |||
| TM helix 2 | 147..169 | CDD:320334 | |||
| TM helix 3 | 185..207 | CDD:320334 | 4/21 (19%) | ||
| TM helix 4 | 230..246 | CDD:320334 | 1/2 (50%) | ||
| TM helix 5 | 274..297 | CDD:320334 | |||
| TM helix 6 | 429..451 | CDD:320334 | |||
| TM helix 7 | 466..491 | CDD:320334 | |||
| LOC1281799 | XP_061497177.1 | None | |||
| Blue background indicates that the domain is not in the aligned region. | |||||