DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCKLR-17D3 and LOC1281799

DIOPT Version :10

Sequence 1:NP_001097023.1 Gene:CCKLR-17D3 / 32864 FlyBaseID:FBgn0030954 Length:584 Species:Drosophila melanogaster
Sequence 2:XP_061497177.1 Gene:LOC1281799 / 1281799 VectorBaseID:AGAMI1_009161 Length:472 Species:Anopheles gambiae


Alignment Length:48 Identity:11/48 - (22%)
Similarity:18/48 - (37%) Gaps:10/48 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 PGWMPFTNCHRFSENSTKISIDFQINRLFGSTLIYEIDLLIEGVLLEL 231
            |.:.|.  ||:..|....::...|        |.:.|.|..:|.:..|
Mosquito    73 PHYCPM--CHQQFERPQHVADHMQ--------LCHGITLNAQGAIATL 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCKLR-17D3NP_001097023.1 7tm_GPCRs 112..498 CDD:475119 11/48 (23%)
TM helix 1 114..138 CDD:320334
TM helix 2 147..169 CDD:320334
TM helix 3 185..207 CDD:320334 4/21 (19%)
TM helix 4 230..246 CDD:320334 1/2 (50%)
TM helix 5 274..297 CDD:320334
TM helix 6 429..451 CDD:320334
TM helix 7 466..491 CDD:320334
LOC1281799XP_061497177.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.