DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12609 and LOC5667711

DIOPT Version :10

Sequence 1:NP_728194.1 Gene:CG12609 / 32862 FlyBaseID:FBgn0030952 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_001688419.3 Gene:LOC5667711 / 5667711 VectorBaseID:AGAMI1_002487 Length:328 Species:Anopheles gambiae


Alignment Length:80 Identity:18/80 - (22%)
Similarity:33/80 - (41%) Gaps:19/80 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 DTSVGDLSETLSTLQARPGDSVSKTKMNQKDLDSEQPTT----------------SRMAKYALAN 274
            |||:.|:...:.|::.:.|..::||:.:..:....|||.                |..|...:.|
Mosquito    54 DTSMKDVLRKIQTMRTQFGQELTKTRRHSMNGSMYQPTVWWYESLSFLQNHIKHRSVDAVPTMEN 118

  Fly   275 DG---QSEDEELYKM 286
            ||   :.:|...|.:
Mosquito   119 DGWKSEHDDSSSYNV 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12609NP_728194.1 MADF_DNA_bdg 35..122 CDD:463144
LOC5667711XP_001688419.3 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.