DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6873 and COF1

DIOPT Version :9

Sequence 1:NP_573321.1 Gene:CG6873 / 32861 FlyBaseID:FBgn0030951 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_013050.1 Gene:COF1 / 850676 SGDID:S000003973 Length:143 Species:Saccharomyces cerevisiae


Alignment Length:145 Identity:40/145 - (27%)
Similarity:78/145 - (53%) Gaps:17/145 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SGINLSRECQHVFEQIRKLKQHRYAVFVIQDEREIKVEVLGVREA----NYDDFLADLQRAGSNQ 63
            ||:.::.|....|..::..|::::.:|.:.|   .|.|:: |:|.    :||.|   |::...|.
Yeast     4 SGVAVADESLTAFNDLKLGKKYKFILFGLND---AKTEIV-VKETSTDPSYDAF---LEKLPEND 61

  Fly    64 CRFAVYDYEYQ-HQCQGTLSTCLKEKLILMLWCPTLARIKDKMLYSSTFAVLKREFPGVQKCIQA 127
            |.:|:||:||: :..:|.     :.|::...|.|..|.::.||:|:|:...|:|...||...:|.
Yeast    62 CLYAIYDFEYEINGNEGK-----RSKIVFFTWSPDTAPVRSKMVYASSKDALRRALNGVSTDVQG 121

  Fly   128 TEPEEACRNAVEEQL 142
            |:..|...::|.|::
Yeast   122 TDFSEVSYDSVLERV 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6873NP_573321.1 ADF_cofilin_like 3..142 CDD:200442 40/143 (28%)
COF1NP_013050.1 ADF_cofilin_like 4..136 CDD:200442 40/143 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346768
Domainoid 1 1.000 92 1.000 Domainoid score I1714
eggNOG 1 0.900 - - E1_KOG1735
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I1453
Isobase 1 0.950 - 0 Normalized mean entropy S1466
OMA 1 1.010 - - QHG53544
OrthoFinder 1 1.000 - - FOG0000392
OrthoInspector 1 1.000 - - otm46802
orthoMCL 1 0.900 - - OOG6_100500
Panther 1 1.100 - - O PTHR11913
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2387
SonicParanoid 1 1.000 - - X134
TreeFam 00.000 Not matched by this tool.
1413.780

Return to query results.
Submit another query.